SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g00770

Feature Type:gene_model
Chromosome:Gm09
Start:412297
stop:415181
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g00770
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G04470AT Annotation by Michelle Graham. TAIR10: Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein | chr4:2227963-2229226 REVERSE LENGTH=190 SoyBaseE_val: 3.00E-88ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005778GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisomal membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
KOG1944 KOG Peroxisomal membrane protein MPV17 and related proteins JGI ISS
PTHR11266Panther PEROXISOMAL MEMBRANE PROTEIN 2, PXMP2 JGI ISS
PF04117PFAM Mpv17 / PMP22 family JGI ISS
UniRef100_I1KZU3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KZU3_SOYBN SoyBaseE_val: 1.00E-129ISS
UniRef100_Q9ZS51UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peroxisomal membrane protein PMP22 n=2 Tax=Arabidopsis thaliana RepID=PMP22_ARATH SoyBaseE_val: 1.00E-85ISS

Expression Patterns of Glyma09g00770
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g00770
ParalogEvidenceComments
Glyma15g11630 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g00770 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g005200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g00770
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g00770
>Glyma09g00770.1   sequence type=CDS   gene model=Glyma09g00770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTCTTTGGCAAAGAAGGGACTCAACAATTACGTCAAACAGCTCCAGCAACACCCTTTGAGAACCAAGGTAATCACTGCAGGGGTACTATCAGCGATCAGCGATGTTGTGTCTCAGAAACTTACCGGGATACAGAAAATTCAACTCAAACGACTTCTTTTCAAAGTGATTTTTGGAGCCGCTTATCTTGGACCCTTTGGACACTTTTTTCATTTAATACTGGATAAAATTTTCAAAGGAAAGAGAGATTCAAAAACTGTGGCTAAGAAGGTTCTGATTGAACAGTTAACATCCAATCCTTGGAACAATTTGCTTTTCATGATTTACTACGGATTAGTTGTTGAAGGACAACCTTGGGTGAATGTGAAAGCTAAAGTTAAGAAGGATTATCTATCAGTGCAGTATACATCATGGACGGTCTGGCCTGTTGTGGGGTGGATAAATCACAAATTCATGCCTCTTCATTTCCGTGTTGTTTTCCAAAGCTTAGTAGCATTTTTCTGGGGAGTATTCTTGAACCTTCGAGCACGATCTATGGCATTGATTAAAGCCTGA
Predicted protein sequences of Glyma09g00770
>Glyma09g00770.1   sequence type=predicted peptide   gene model=Glyma09g00770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSLAKKGLNNYVKQLQQHPLRTKVITAGVLSAISDVVSQKLTGIQKIQLKRLLFKVIFGAAYLGPFGHFFHLILDKIFKGKRDSKTVAKKVLIEQLTSNPWNNLLFMIYYGLVVEGQPWVNVKAKVKKDYLSVQYTSWTVWPVVGWINHKFMPLHFRVVFQSLVAFFWGVFLNLRARSMALIKA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo