Glyma08g48290 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g48290

Feature Type:	gene_model
Chromosome:	Gm08
Start:	46932355
stop:	46934012
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g48290

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G61570	AT	Annotation by Michelle Graham. TAIR10: translocase of the inner mitochondrial membrane 13 \| chr1:22718897-22719473 REVERSE LENGTH=87	SoyBase	E_val: 1.00E-22	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006626	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion	SoyBase	N/A	ISS
GO:0045039	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005743	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0005758	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial intermembrane space	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0015450	GO-mf	Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity	SoyBase	N/A	ISS
KOG1733	KOG	Mitochondrial import inner membrane translocase, subunit TIM13	JGI		ISS
PTHR19338	Panther	TRANSLOCASE OF INNER MITOCHONDRIAL MEMBRANE 13 HOMOLOG	JGI		ISS
PF02953	PFAM	Tim10/DDP family zinc finger	JGI		ISS
UniRef100_C6TNN4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TNN4_SOYBN	SoyBase	E_val: 3.00E-54	ISS
UniRef100_G7J7C6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial import inner membrane translocase subunit Tim13 n=1 Tax=Medicago truncatula RepID=G7J7C6_MEDTR	SoyBase	E_val: 2.00E-34	ISS

Expression Patterns of Glyma08g48290

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g48290 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g367400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g48290

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g48290

Limit To All Plant Sequences

>Glyma08g48290.1   sequence type=CDS   gene model=Glyma08g48290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTCGTTCTCAAATCAATCGAGAGGGTCGTCGAGCCAATTATCTGCTCAGGATCTCAAAAACCAGTTGAAGAACCAACTTGCCATTGAGTATGCTCAACAATTTCTTGAGACAGTGGGAAGAAAGTGTTTTGAGAAGTGTGTTACAAAACCAGGTTCAAGCCTCGGTGGGAGTGAAAGCAGTTGCATCTCTAGGTGCGTAGATCGATATATTGAAGCCACAGGCATAATTAGCAAAGCGTTATTTAGTTCACAATGA

Predicted protein sequences of Glyma08g48290

Limit To All Plant Sequences

>Glyma08g48290.1   sequence type=predicted peptide   gene model=Glyma08g48290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSFSNQSRGSSSQLSAQDLKNQLKNQLAIEYAQQFLETVGRKCFEKCVTKPGSSLGGSESSCISRCVDRYIEATGIISKALFSSQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain