SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g48290): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g48290): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g48290

Feature Type:gene_model
Chromosome:Gm08
Start:46932355
stop:46934012
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G61570AT Annotation by Michelle Graham. TAIR10: translocase of the inner mitochondrial membrane 13 | chr1:22718897-22719473 REVERSE LENGTH=87 SoyBaseE_val: 1.00E-22ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0045039GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into mitochondrial inner membrane SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005743GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane SoyBaseN/AISS
GO:0005758GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial intermembrane space SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0015450GO-mf Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity SoyBaseN/AISS
KOG1733 KOG Mitochondrial import inner membrane translocase, subunit TIM13 JGI ISS
PTHR19338Panther TRANSLOCASE OF INNER MITOCHONDRIAL MEMBRANE 13 HOMOLOG JGI ISS
PF02953PFAM Tim10/DDP family zinc finger JGI ISS
UniRef100_C6TNN4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TNN4_SOYBN SoyBaseE_val: 3.00E-54ISS
UniRef100_G7J7C6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial import inner membrane translocase subunit Tim13 n=1 Tax=Medicago truncatula RepID=G7J7C6_MEDTR SoyBaseE_val: 2.00E-34ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g48290 not represented in the dataset

Glyma08g48290 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g367400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g48290.1   sequence type=CDS   gene model=Glyma08g48290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTCGTTCTCAAATCAATCGAGAGGGTCGTCGAGCCAATTATCTGCTCAGGATCTCAAAAACCAGTTGAAGAACCAACTTGCCATTGAGTATGCTCAACAATTTCTTGAGACAGTGGGAAGAAAGTGTTTTGAGAAGTGTGTTACAAAACCAGGTTCAAGCCTCGGTGGGAGTGAAAGCAGTTGCATCTCTAGGTGCGTAGATCGATATATTGAAGCCACAGGCATAATTAGCAAAGCGTTATTTAGTTCACAATGA

>Glyma08g48290.1   sequence type=predicted peptide   gene model=Glyma08g48290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSFSNQSRGSSSQLSAQDLKNQLKNQLAIEYAQQFLETVGRKCFEKCVTKPGSSLGGSESSCISRCVDRYIEATGIISKALFSSQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo