Glyma08g48091 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g48091

Feature Type:	gene_model
Chromosome:	Gm08
Start:	46808465
stop:	46811701
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g48091

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G67080	AT	Annotation by Michelle Graham. TAIR10: abscisic acid (aba)-deficient 4 \| chr1:25045405-25046681 REVERSE LENGTH=220	SoyBase	E_val: 3.00E-74	ISS
GO:0009688	GO-bp	Annotation by Michelle Graham. GO Biological Process: abscisic acid biosynthetic process	SoyBase	N/A	ISS
GO:0010117	GO-bp	Annotation by Michelle Graham. GO Biological Process: photoprotection	SoyBase	N/A	ISS
GO:0016122	GO-bp	Annotation by Michelle Graham. GO Biological Process: xanthophyll metabolic process	SoyBase	N/A	ISS
GO:0032928	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of superoxide anion generation	SoyBase	N/A	ISS
GO:0042744	GO-bp	Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process	SoyBase	N/A	ISS
GO:0009517	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: PSII associated light-harvesting complex II	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
UniRef100_D7R521	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Neoxanthin synthase n=1 Tax=Citrus sinensis RepID=D7R521_CITSI	SoyBase	E_val: 1.00E-88	ISS
UniRef100_UPI0002337F95	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002337F95 related cluster n=1 Tax=unknown RepID=UPI0002337F95	SoyBase	E_val: 4.00E-163	ISS

Expression Patterns of Glyma08g48091

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g48091 not represented in the dataset	Glyma08g48091 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g48091

Paralog	Evidence	Comments
Glyma18g53400	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g48091 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g365700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g48091

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g48091

Limit To All Plant Sequences

>Glyma08g48091.1   sequence type=CDS   gene model=Glyma08g48091   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTTTCTCTTCTTGCTTTTCCCATTCTCCATTGACATTCAAGGCTATGAAACCTTGTGGTTCTGTTGGGAAGGGGCAAAATTTTGCTTTCCCTATCAGAAGTAATGGTGCTGAGCTTTGTAAGGGACGCATTGTGAGAAGTAGAGTCAACTTAAGCGGAGATTGGAATTTCATGGGAGGATCCAGAATTATTGTGAAACCAACAGCTACAAGATTGCTTCTTCATTATCCAAAAAGGGGTCAAATGAAAGTTTCATGCTTCATAGGATCTCAACTTGCTAGCACTGCATTTACAGCAGGAACAATAGCAGTGCTCCCATTTTACACACTTATGAAGTCTATGGAGAGTAGTATACCGTATGTAGTGCTTAGCATTCTATATGCATATTTGTTGTACCTTTCTTGGACCCCTGAGACAGTTCGGTTGATTTTTGCAAGTAAATACTTGCTACCAGAGCTGCCTGGTATAGCAAAAATGTTCTCGAGTGAGATGACTTTGGCCTCTGCTTGGATTCACCTGTTGGTTATTGATCTTTTTGCTGCAAGGCATGTTTTCCAAGATGGACTGAAGAATCAGATTGAAACTCGGCATTCTGTTTCTTTTTGCTTGTTCTTTTGCCCCATTGGAATTCTTACTCATGTCATCACCAAAGCCATGACCAAACCTGCCACAAAAGAGGGTCATGGTTTATAG

Predicted protein sequences of Glyma08g48091

Limit To All Plant Sequences

>Glyma08g48091.1   sequence type=predicted peptide   gene model=Glyma08g48091   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSFSSCFSHSPLTFKAMKPCGSVGKGQNFAFPIRSNGAELCKGRIVRSRVNLSGDWNFMGGSRIIVKPTATRLLLHYPKRGQMKVSCFIGSQLASTAFTAGTIAVLPFYTLMKSMESSIPYVVLSILYAYLLYLSWTPETVRLIFASKYLLPELPGIAKMFSSEMTLASAWIHLLVIDLFAARHVFQDGLKNQIETRHSVSFCLFFCPIGILTHVITKAMTKPATKEGHGL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain