SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g47941

Feature Type:gene_model
Chromosome:Gm08
Start:46703146
stop:46704596
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g47941
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G67140AT Annotation by Michelle Graham. TAIR10: HEAT repeat-containing protein | chr1:25101016-25117372 REVERSE LENGTH=2223 SoyBaseE_val: 4.00E-33ISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0005982GO-bp Annotation by Michelle Graham. GO Biological Process: starch metabolic process SoyBaseN/AISS
GO:0005991GO-bp Annotation by Michelle Graham. GO Biological Process: trehalose metabolic process SoyBaseN/AISS
GO:0009616GO-bp Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing SoyBaseN/AISS
GO:0009630GO-bp Annotation by Michelle Graham. GO Biological Process: gravitropism SoyBaseN/AISS
GO:0010050GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative phase change SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010267GO-bp Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference SoyBaseN/AISS
GO:0016926GO-bp Annotation by Michelle Graham. GO Biological Process: protein desumoylation SoyBaseN/AISS
GO:0035196GO-bp Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA SoyBaseN/AISS
GO:0050665GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
UniRef100_F4HRS2UniRef Annotation by Michelle Graham. Most informative UniRef hit: HEAT repeat-containing protein n=4 Tax=Arabidopsis thaliana RepID=F4HRS2_ARATH SoyBaseE_val: 2.00E-30ISS
UniRef100_I1N5D1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N5D1_SOYBN SoyBaseE_val: 1.00E-138ISS

Expression Patterns of Glyma08g47941
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g47941 not represented in the dataset
Glyma08g47941 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g47941
ParalogEvidenceComments
Glyma18g53545 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g47941 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma08g47941
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g47941
>Glyma08g47941.1   sequence type=CDS   gene model=Glyma08g47941   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACCTACTTCTGGAGGCCATTGTCATGATTTTCTTGTCAACAGAAGACGGGATCTCTCAGGAAGTCAATAATTTAAGAAGCACAACTGTTAAACTTGTTTCTCGCCTTGCTCAAATTCCTTCATCAGCCATTCATGTCAAGGATGTTTTACTATCAATGCCTCCTCTTCACCGCCAGCAACTTCAGGGTGTAATACGAGCTTCTGTAACTCATGATAAAAATCCAACAGATATAAAAGTACCAGTTTTGGACATAAAAATGCCAAAGCCATCGGAAGGAACTGAAGAGAAACATACCATACCATCATCTGCTGCTGTGATGCAGACAGATGAAAATGACAAGGAAGAAGATGAGTTTAGTGAAGATGATTGGGATGCATTTCAGTCGTTTCCTGTCTCTAAAAGTGAGGATGAAGATGATTCAAAAACAGAGCATGTTGCTGAAGGCAAGGATCCTAGCACAGTTAAAATGTCATCAGAAATAGAAAGTTCTATTGGAGGTGTTGAGTTTCAAGATTTTTTTATTTCCAAATCCATCAATAGTGAAAAGGAGCTGAAAGGTGATGAATGTCTGGAGGCTGTCAAAGAGAAACATGATCAAACTTATCCTAGTACTAACAAGCCACATGATAATGAGAATCAAGAGATGGAGGGAAAATTGCAAACCTCGGGCTTCAAGAAGAGGGGACATCAATCCCAGGAAATGAACTAA
Predicted protein sequences of Glyma08g47941
>Glyma08g47941.1   sequence type=predicted peptide   gene model=Glyma08g47941   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNLLLEAIVMIFLSTEDGISQEVNNLRSTTVKLVSRLAQIPSSAIHVKDVLLSMPPLHRQQLQGVIRASVTHDKNPTDIKVPVLDIKMPKPSEGTEEKHTIPSSAAVMQTDENDKEEDEFSEDDWDAFQSFPVSKSEDEDDSKTEHVAEGKDPSTVKMSSEIESSIGGVEFQDFFISKSINSEKELKGDECLEAVKEKHDQTYPSTNKPHDNENQEMEGKLQTSGFKKRGHQSQEMN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo