Glyma08g47823 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g47823

Feature Type:	gene_model
Chromosome:	Gm08
Start:	46621704
stop:	46622185
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g47823

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G62040	AT	Annotation by Michelle Graham. TAIR10: PEBP (phosphatidylethanolamine-binding protein) family protein \| chr5:24922810-24923709 FORWARD LENGTH=177	SoyBase	E_val: 1.00E-33	ISS
GO:0009908	GO-bp	Annotation by Michelle Graham. GO Biological Process: flower development	SoyBase	N/A	ISS
GO:0010228	GO-bp	Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0008429	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphatidylethanolamine binding	SoyBase	N/A	ISS
PTHR11362	Panther	PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN	JGI		ISS
PF01161	PFAM	Phosphatidylethanolamine-binding protein	JGI		ISS
UniRef100_G7Z0A7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Flowering locus T-like protein 7 n=1 Tax=Glycine max RepID=G7Z0A7_SOYBN	SoyBase	E_val: 3.00E-55	ISS
UniRef100_G7Z0A7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Flowering locus T-like protein 7 n=1 Tax=Glycine max RepID=G7Z0A7_SOYBN	SoyBase	E_val: 3.00E-55	ISS

Proteins Associated with Glyma08g47823

Locus	Gene Symbol	Protein Name
	FT6	Flowering locus T gene 6
	FTL7	Flowering locus T-like gene 7

Expression Patterns of Glyma08g47823

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g47823 not represented in the dataset	Glyma08g47823 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g47823 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g363200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g47823

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g47823

Limit To All Plant Sequences

>Glyma08g47823.1   sequence type=CDS   gene model=Glyma08g47823   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTATTACAACGAACCCTCTTGTTGTTGGACGTGTAATAGGAGATGTTCTGGAGCCATTTGCAAGTTCTATCCCTTTGAGAGTTGTTTACAACAATAACAAAGAAGTCATCAACAGTGGAGAGCTCAAACCCTCCCAAATAATCAACCCTCCACGAGTTGAGGTTGGTGGTGATGACCTCAGGACCCTCTACACTCTGGTCATGGTGGACCCTGATGCACCCAGCCCAAGTGACCCAAATATGAGGGAATATCTGCACTGGTAA

Predicted protein sequences of Glyma08g47823

Limit To All Plant Sequences

>Glyma08g47823.1   sequence type=predicted peptide   gene model=Glyma08g47823   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAITTNPLVVGRVIGDVLEPFASSIPLRVVYNNNKEVINSGELKPSQIINPPRVEVGGDDLRTLYTLVMVDPDAPSPSDPNMREYLHW*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain