Report for Sequence Feature Glyma08g47810
Feature Type: gene_model
Chromosome: Gm08
Start: 46606934
stop: 46608654
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g47810
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G65480 AT
Annotation by Michelle Graham. TAIR10: PEBP (phosphatidylethanolamine-binding protein) family protein | chr1:24331510-24333689 FORWARD LENGTH=175
SoyBase E_val: 7.00E-82 ISS
GO:0009909 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of flower development
SoyBase N/A ISS
GO:0009911 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of flower development
SoyBase N/A ISS
GO:0010119 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of stomatal movement
SoyBase N/A ISS
GO:0048573 GO-bp
Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0008429 GO-mf
Annotation by Michelle Graham. GO Molecular Function: phosphatidylethanolamine binding
SoyBase N/A ISS
KOG3346
KOG
Phosphatidylethanolamine binding protein
JGI ISS
PTHR11362 Panther
PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN
JGI ISS
PF01161 PFAM
Phosphatidylethanolamine-binding protein
JGI ISS
UniRef100_G7Z0A8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Flowering locus T-like protein 8 n=2 Tax=Glycine max RepID=G7Z0A8_SOYBN
SoyBase E_val: 3.00E-123 ISS
UniRef100_G7Z0A8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Flowering locus T-like protein 8 n=2 Tax=Glycine max RepID=G7Z0A8_SOYBN
SoyBase E_val: 3.00E-123 ISS
Proteins Associated with Glyma08g47810
Locus Gene Symbol Protein Name
FT4 Flowering locus T gene 4
FT4 Flowering Locus T 4
FT4 Flowering Locus T 4
Expression Patterns of Glyma08g47810
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g47810
Paralog Evidence Comments
Glyma18g53680 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g47810 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g363100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g47810
Coding sequences of Glyma08g47810
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g47810.1 sequence type=CDS gene model=Glyma08g47810 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCCTATATCAATGGACCCCCTTGTTCTTGGACGTATAATAGGAGATATTTTGGATCCCTTCACGAGTTCTGTTTCTCTGAGGGTTGTTTATAACAACCAGTCATCGGTTATCAATAGTTGTGAGTTCAAACCTTCCCAAATCGTCAACAAACCAAGAATTAATATTCGTGGAAATGACCTAGGGATCTTTTACACTCTGATAATGGTGAACCCCGATGCTCCTAGCCCAAGTGACCCACATATGAAGGAATATTTGCATTGGTTGGTAACCAATATTCCAGCATCTACAGGGGCAACCACTGGAGAAGAGATTGTGGAGTATGAAAGTCCACGACCAACTTCTGGGATTCATCGGATTGCTTTTGTGTTGTTTCGTCAATTTGATAGACAAATTGTGCATGCTCCAAGATGGCGCCAAAATTTCAACACTAGAGATTTTGCTGAGGTTTACAACCTTGGATCACCAGTTGCTGCTGTGTATTTCAACTGTCAACGTGAAGGTGGTTGGGGTGGACGAAGGAGATGA
Predicted protein sequences of Glyma08g47810
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g47810.1 sequence type=predicted peptide gene model=Glyma08g47810 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MPISMDPLVLGRIIGDILDPFTSSVSLRVVYNNQSSVINSCEFKPSQIVNKPRINIRGNDLGIFYTLIMVNPDAPSPSDPHMKEYLHWLVTNIPASTGATTGEEIVEYESPRPTSGIHRIAFVLFRQFDRQIVHAPRWRQNFNTRDFAEVYNLGSPVAAVYFNCQREGGWGGRRR*