Glyma08g47760 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g47760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g47760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g47760

Feature Type:	gene_model
Chromosome:	Gm08
Start:	46555748
stop:	46558918
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g47760

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G05785	AT	Annotation by Michelle Graham. TAIR10: Got1/Sft2-like vescicle transport protein family \| chr1:1730981-1732406 FORWARD LENGTH=135	SoyBase	E_val: 2.00E-51	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG1743	KOG	Ferric reductase-like proteins	JGI		ISS
PTHR21493	Panther	CGI-141-RELATED/LIPASE CONTAINING PROTEIN	JGI		ISS
PTHR21493:SF10	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF04178	PFAM	Got1/Sft2-like family	JGI		ISS
UniRef100_A2Q4X9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Got1-like protein n=1 Tax=Medicago truncatula RepID=A2Q4X9_MEDTR	SoyBase	E_val: 1.00E-59	ISS
UniRef100_I1KZI8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KZI8_SOYBN	SoyBase	E_val: 8.00E-80	ISS

Expression Patterns of Glyma08g47760

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g47760 not represented in the dataset	Glyma08g47760 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g47760

Paralog	Evidence	Comments
Glyma18g53730	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g47760 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g362600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g47760

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g47760

Limit To All Plant Sequences

>Glyma08g47760.1   sequence type=CDS   gene model=Glyma08g47760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTATGAGATAACTGAGATAAAGAAGATTGGCATAGGCCTAATTGGTTTCGGCATATTTTTCGCATTTCTTGGCATAATTCTTTTCTTTGACCGTGGTTTGCTTGCTCTGGGAAATATTTTTTCCTTGGCAGGGGTAGCCATTTTGCTTGGTTGGCGTTCCACGTGGGCACTCTTCACATATAGAGCAAACTTTAAGGGTTCTGCATCATTTCTACTAGGTCTCTTTTTCATTTGTGTGAGGTGGCCAATTGTTGGTATAATACTTGAAATATACAGTTGTGTTTTTCTCTTCAGTGGATTTTGGTCATCTATCAAAGTGTTCCTCTATCATATCCCTGTTGTTGGATGGATTATACAGTTTATCTCTCCTCCTTGA

Predicted protein sequences of Glyma08g47760

Limit To All Plant Sequences

>Glyma08g47760.1   sequence type=predicted peptide   gene model=Glyma08g47760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAYEITEIKKIGIGLIGFGIFFAFLGIILFFDRGLLALGNIFSLAGVAILLGWRSTWALFTYRANFKGSASFLLGLFFICVRWPIVGIILEIYSCVFLFSGFWSSIKVFLYHIPVVGWIIQFISPP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain