Report for Sequence Feature Glyma08g47610
Feature Type: gene_model
Chromosome: Gm08
Start: 46416883
stop: 46418682
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g47610
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G31680 AT
Annotation by Michelle Graham. TAIR10: RAB GTPase homolog A5D | chr2:13473781-13474957 REVERSE LENGTH=219
SoyBase E_val: 9.00E-128 ISS
GO:0007264 GO-bp
Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction
SoyBase N/A ISS
GO:0015031 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein transport
SoyBase N/A ISS
GO:0005794 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0005525 GO-mf
Annotation by Michelle Graham. GO Molecular Function: GTP binding
SoyBase N/A ISS
KOG0087
KOG
GTPase Rab11/YPT3, small G protein superfamily
JGI ISS
PTHR24073 Panther
FAMILY NOT NAMED
JGI ISS
PTHR24073:SF213 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF00071 PFAM
Ras family
JGI ISS
UniRef100_Q39860 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: GTPase n=1 Tax=Glycine max RepID=Q39860_SOYBN
SoyBase E_val: 2.00E-159 ISS
UniRef100_Q39860 UniRef
Annotation by Michelle Graham. Best UniRef hit: GTPase n=1 Tax=Glycine max RepID=Q39860_SOYBN
SoyBase E_val: 2.00E-159 ISS
Expression Patterns of Glyma08g47610
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma08g47610
Paralog Evidence Comments
Glyma18g53870 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g47610 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g361000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g47610
Coding sequences of Glyma08g47610
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g47610.1 sequence type=CDS gene model=Glyma08g47610 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCTGGTTCGGAGGACGAGGGAGGAGAAGAGTACCTCTTCAAGATCGTCATAATCGGAGACTCCGCGGTGGGGAAATCGAACCTGCTGTCCCGCTACGCCCGGAACGAGTTCAACATGCACTCCAAGGCCACCATAGGCGTCGAGTTCCAGACTCAGTGCTTGGAAATCGACTCCAAGGAAGTCAAGGCTCAGATTTGGGACACCGCCGGCCAAGAGCGATTCCGCGCCGTCACCTCCGCCTACTACCGCGGCGCTGTCGGCGCCCTCATTGTCTACGACATCTCCCGCCGCACCACCTTCGATAGCGTCGGTCGCTGGCTCGACGAGCTTAAAACTCACTGCGATACAACGGTGGCAATGATGCTAGTGGGGAACAAATGTGACTTGGAGAATATAAGGGCGGTGAGCATTGACGAGGGGAAAAGCCTTGCGGAAGCGGAAGGTTTGTTTTTCATGGAAACGTCAGCGTTGGACTCGACAAACGTGAAGATGGCATTTGAGATGGTAATTCGAGAGATATACAACAACGTGAGCAGGAAGGTTCTCAACTCCGAAACATACAAGGCAGAGTTATCTGTCAACAGGGTCAGCCTCGTCAACAATGGTGCTGCTACATCTAAGCAAAATCAAACCTACTTTTCTTGTTGTTCCCGATGA
Predicted protein sequences of Glyma08g47610
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g47610.1 sequence type=predicted peptide gene model=Glyma08g47610 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSGSEDEGGEEYLFKIVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQCLEIDSKEVKAQIWDTAGQERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKTHCDTTVAMMLVGNKCDLENIRAVSIDEGKSLAEAEGLFFMETSALDSTNVKMAFEMVIREIYNNVSRKVLNSETYKAELSVNRVSLVNNGAATSKQNQTYFSCCSR*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
