SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g47580

Feature Type:gene_model
Chromosome:Gm08
Start:46399883
stop:46401127
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g47580
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G50760AT Annotation by Michelle Graham. TAIR10: SAUR-like auxin-responsive protein family | chr5:20644780-20645331 FORWARD LENGTH=183 SoyBaseE_val: 4.00E-22ISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF02519PFAM Auxin responsive protein JGI ISS
UniRef100_B9GMP4UniRef Annotation by Michelle Graham. Most informative UniRef hit: SAUR family protein n=1 Tax=Populus trichocarpa RepID=B9GMP4_POPTR SoyBaseE_val: 1.00E-46ISS
UniRef100_I1KZG5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KZG5_SOYBN SoyBaseE_val: 2.00E-116ISS

Expression Patterns of Glyma08g47580
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g47580
ParalogEvidenceComments
Glyma18g53900 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g47580 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g360700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g47580
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g47580
>Glyma08g47580.1   sequence type=CDS   gene model=Glyma08g47580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGATGTTGATGAGAGTACTAAGAAGGGAAAAGGGAATAAGAAAGGTGGTGGTGGGCTGATCACGAAAACATGGGAGCGATGCAAGTCCATAGGACGAGGCCGAAAGGTAACTTCTTCTTCAACTAATACTAATACTAATACTATGAGAAGCAAATCATGGCCAAGGCGTGACCGAGAAAACAAAAACAAAAACAGTACTACTATTGTGGCCCCCGAAGGTTGCTTCTCGGTGTATGTTGGACCCCAAATGCAAAGGTTTGTAATCAAAACCGAGTACGCAAGCCACCCCTTGTTCAAGATGTTGCTCGAAGAAGCTGAATCTGAGTATGGTTACAACAGCCAAGGCCCTTTGGCCCTTCCCTGCCACGTTGATGTCTTCTACATGGTCTTGATGGAAATGGGTTCTGATGAAACTCAAACCACTCCTCAGGGCTGTGCCTGCGTTAAGCGATCTCCCTCTGCTTATCAACCTATGAAGTACCAACACTCTCCCTCTGCTTATCAACCTATGAAGTACCGACACTGA
Predicted protein sequences of Glyma08g47580
>Glyma08g47580.1   sequence type=predicted peptide   gene model=Glyma08g47580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDDVDESTKKGKGNKKGGGGLITKTWERCKSIGRGRKVTSSSTNTNTNTMRSKSWPRRDRENKNKNSTTIVAPEGCFSVYVGPQMQRFVIKTEYASHPLFKMLLEEAESEYGYNSQGPLALPCHVDVFYMVLMEMGSDETQTTPQGCACVKRSPSAYQPMKYQHSPSAYQPMKYRH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo