SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g47450

Feature Type:gene_model
Chromosome:Gm08
Start:46299988
stop:46300528
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g47450
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G07050AT Annotation by Michelle Graham. TAIR10: cycloartenol synthase 1 | chr2:2924629-2930295 FORWARD LENGTH=759 SoyBaseE_val: 6.00E-69ISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0006655GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019745GO-bp Annotation by Michelle Graham. GO Biological Process: pentacyclic triterpenoid biosynthetic process SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0016866GO-mf Annotation by Michelle Graham. GO Molecular Function: intramolecular transferase activity SoyBaseN/AISS
GO:0016871GO-mf Annotation by Michelle Graham. GO Molecular Function: cycloartenol synthase activity SoyBaseN/AISS
PTHR11764Panther SQUALENE CYCLASES-RELATED JGI ISS
PTHR11764:SF3Panther CYCLOARTENOL SYNTHASE-RELATED JGI ISS
PF00432PFAM Prenyltransferase and squalene oxidase repeat JGI ISS
UniRef100_Q2WGL6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cycloartenol synthase n=1 Tax=Lotus japonicus RepID=Q2WGL6_LOTJA SoyBaseE_val: 2.00E-75ISS
UniRef100_UPI0002337DD0UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337DD0 related cluster n=1 Tax=unknown RepID=UPI0002337DD0 SoyBaseE_val: 4.00E-88ISS

Expression Patterns of Glyma08g47450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g47450 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma08g47450
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g47450
>Glyma08g47450.1   sequence type=CDS   gene model=Glyma08g47450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTAATTACTCTGTCTATCACTGGGGCGTTGAATGCAGTCTTAACTGAAGAACATAGAAAGGAAATATGCCGTTACCTCTATAATCATCAAAACAAGGATGGTGGGTGGGGTTTGCATATTGAAGGTCCTAGCACCATGTTTGGCTCTGTCTTGAGTTATATTACTCTGAGATTGCTAGGTGAGGGACCTAATGATGGACAAGGGGAAATGGAGAAGGCACGTGACTTGATTCTAGGGCATGGCGGTGCTACTTATATAACGTCATGGGGGAAGATGTGGCTTTCAGTACTTGGAGTTTATGAATGGTCCGGAAATAATCCCCTGCCCCCTGAGATATGGCTCCTTCCATACATGCTTCCATTTCATCCAGGTTCTTGCTCTTTGTTCTGTTTTCTT
Predicted protein sequences of Glyma08g47450
>Glyma08g47450.1   sequence type=predicted peptide   gene model=Glyma08g47450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VITLSITGALNAVLTEEHRKEICRYLYNHQNKDGGWGLHIEGPSTMFGSVLSYITLRLLGEGPNDGQGEMEKARDLILGHGGATYITSWGKMWLSVLGVYEWSGNNPLPPEIWLLPYMLPFHPGSCSLFCFL






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo