Glyma08g47060 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g47060

Feature Type:	gene_model
Chromosome:	Gm08
Start:	45987679
stop:	45989771
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g47060

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G48850	AT	Annotation by Michelle Graham. TAIR10: Tetratricopeptide repeat (TPR)-like superfamily protein \| chr5:19805576-19807699 REVERSE LENGTH=306	SoyBase	E_val: 2.00E-111	ISS
GO:0006792	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of sulfur utilization	SoyBase	N/A	ISS
GO:0010438	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to sulfur starvation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
PTHR23083	Panther	O-LINKED N-ACETYLGLUCOSAMINE TRANSFERASE, OGT	JGI		ISS
PTHR23083:SF200	Panther	OS05G0506000 PROTEIN	JGI		ISS
UniRef100_G7L2A9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Male sterility 5 family protein n=1 Tax=Medicago truncatula RepID=G7L2A9_MEDTR	SoyBase	E_val: 1.00E-153	ISS
UniRef100_I1KZB4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KZB4_SOYBN	SoyBase	E_val: 6.00E-179	ISS

Expression Patterns of Glyma08g47060

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g47060

Paralog	Evidence	Comments
Glyma18g38050	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g47060 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g355800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g47060

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g47060

Limit To All Plant Sequences

>Glyma08g47060.1   sequence type=CDS   gene model=Glyma08g47060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCTGGTAGAAAAGAACCCAGAAGCTGCAATTGTATTGTTTCGGAAAGCAATAAATTCTGGGGATAAAGTGGACAGTGCTCTAAAGGATATGGCAGTAGTGATGAAGCAATTGGACAGATCTGAAGAAGCTATTGAAGCCATTCGTTCATTTAGAAGCCTTTGCTCCAAACAATCCCAAGAGTCCCTTGATAATGTACTAATAGATCTTTACAAGAAATGTGGAAAAATAGATGAGCAAATAGAAATGCTGAAGCGAAAGTTGAAGTTGATATACCAGGGTGAGGCTTTCAATGGGAAACTCTCTAAGACAGCAAGGTCTCATGGCAAGAAGTTCCAAGTTTCTATGAAACAAGAAACTTCAAGATTACTGGGAAACCTGGGCTGGGCCTACATGCAAAAGATGAACTACATGATGGAAGAAGTGGTGTATCGGAAAGTCCAAATGATTGATCCAGATTGTAACAAGGCCTGTAACTTGGGCCTATGCCTCATCAGACAAGCCAGATATGAAGAGGCACAATTGATCCTGGATGATGTATTAAAAGGAAATCTTCCAGGCTCAGATGATAGCAAGTCAAGGAAACGGGCCCAAGATCTCCTAACAGAATTGAGATCCATGCTACCTCCACCACATTTCTCAGATCTTTTGGGCCTGGATGATGAGTTCATCAAAGGCCTGGAACAATTGATGAATGAATGGGGGCCTATTAGATCAAAGAGACTTCCAATTTTTTAG

Predicted protein sequences of Glyma08g47060

Limit To All Plant Sequences

>Glyma08g47060.1   sequence type=predicted peptide   gene model=Glyma08g47060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKLVEKNPEAAIVLFRKAINSGDKVDSALKDMAVVMKQLDRSEEAIEAIRSFRSLCSKQSQESLDNVLIDLYKKCGKIDEQIEMLKRKLKLIYQGEAFNGKLSKTARSHGKKFQVSMKQETSRLLGNLGWAYMQKMNYMMEEVVYRKVQMIDPDCNKACNLGLCLIRQARYEEAQLILDDVLKGNLPGSDDSKSRKRAQDLLTELRSMLPPPHFSDLLGLDDEFIKGLEQLMNEWGPIRSKRLPIF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain