Report for Sequence Feature Glyma08g46940
Feature Type: gene_model
Chromosome: Gm08
Start: 45903758
stop: 45906748
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g46940
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G07090 AT
Annotation by Michelle Graham. TAIR10: PPPDE putative thiol peptidase family protein | chr3:2243153-2244476 REVERSE LENGTH=265
SoyBase E_val: 3.00E-124 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
KOG0324
KOG
Uncharacterized conserved protein
JGI ISS
PTHR12378 Panther
UNCHARACTERIZED
JGI ISS
PF05903 PFAM
PPPDE putative peptidase domain
JGI ISS
UniRef100_G7L195 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: PPPDE peptidase domain-containing protein n=1 Tax=Medicago truncatula RepID=G7L195_MEDTR
SoyBase E_val: 3.00E-148 ISS
UniRef100_I1KZA2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KZA2_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma08g46940
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma08g46940
Paralog Evidence Comments
Glyma18g36840 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g46940 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g354700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g46940
Coding sequences of Glyma08g46940
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g46940.1 sequence type=CDS gene model=Glyma08g46940 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTGAGGAGGGTCACAGGGTTACTCTAAATGTTTATGACTTGAGCCAAGGTCTTGCACGGCAGCTTTCAATGTCCTTTTTGGGGAAAGCTATTGAAGGCATATGGCACACAGGAGTTGTTGTTTATGGTAATGAGTATTACTTTGGTGGGGGTATTCAACACTCTCCTGCTGGATCAACTCCATATGGAACTCCACTAAGAGTGGTAGACTTAGGTGTGACACATGTTCCCAAGGATGTCTTTGAAATGTATTTGCAGGAAATCAGTCCGCAGTACCTGCCTGAAACATATAGTCTGCTTACTCATAATTGCAACAACTTCAGCAATGAGGTTGCTCAATTTTTGGTTGGTGCGTCCATTCCTGAATATATTCTCCAGCTGCCCAATGAAGTCATGAGCAGCCCAATGGGAGCTCTTATATTGCCTATGATACAGAATCTTGAGACAACACTGAAATCTGGTGGAGTTCCTCAAGTACCACAATTCAAGCCTGCAACTACTCTGAATGTTTCAGCTAACACCCAAAAGAACTCAAGTACCTCCAACTCATCCAGTGAGAATGGGGTGAGCAGAGAGGTGAACAAGGAAGTGAAGGGCAAAGATGAAAACTCTAAGGCAGCACCTTCTGCAAACACAACAGGGCAACCACAAAAGCCATCACTAAATGGGGTCACAGCAGACCCTCTTGGAGATGCACGCAACAAGGTTCAAGATGAGATTCTCAAAGAGTTTGCTGCAATTATGGCAAGTGGGACAATGCGTGCTAGTGAGGCTGCAGCTCTAGCCACTAAAAGAGTCATGCAAAGATACGGCCATACTACTGCTGTGTCTCAGAATTAG
Predicted protein sequences of Glyma08g46940
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g46940.1 sequence type=predicted peptide gene model=Glyma08g46940 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAEEGHRVTLNVYDLSQGLARQLSMSFLGKAIEGIWHTGVVVYGNEYYFGGGIQHSPAGSTPYGTPLRVVDLGVTHVPKDVFEMYLQEISPQYLPETYSLLTHNCNNFSNEVAQFLVGASIPEYILQLPNEVMSSPMGALILPMIQNLETTLKSGGVPQVPQFKPATTLNVSANTQKNSSTSNSSSENGVSREVNKEVKGKDENSKAAPSANTTGQPQKPSLNGVTADPLGDARNKVQDEILKEFAAIMASGTMRASEAAALATKRVMQRYGHTTAVSQN*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
