Report for Sequence Feature Glyma08g46850
Feature Type: gene_model
Chromosome: Gm08
Start: 45827926
stop: 45829613
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g46850
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G48760 AT
Annotation by Michelle Graham. TAIR10: Ribosomal protein L13 family protein | chr5:19771315-19772686 REVERSE LENGTH=206
SoyBase E_val: 3.00E-134 ISS
GO:0001510 GO-bp
Annotation by Michelle Graham. GO Biological Process: RNA methylation
SoyBase N/A ISS
GO:0006412 GO-bp
Annotation by Michelle Graham. GO Biological Process: translation
SoyBase N/A ISS
GO:0009664 GO-bp
Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization
SoyBase N/A ISS
GO:0042545 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell wall modification
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0005840 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: ribosome
SoyBase N/A ISS
GO:0015934 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit
SoyBase N/A ISS
GO:0022625 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit
SoyBase N/A ISS
GO:0022626 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome
SoyBase N/A ISS
GO:0003735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome
SoyBase N/A ISS
KOG3204
KOG
60S ribosomal protein L13a
JGI ISS
PTHR11545 Panther
RIBOSOMAL PROTEIN L13
JGI ISS
PF00572 PFAM
Ribosomal protein L13
JGI ISS
UniRef100_B9S526 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L13a, putative n=1 Tax=Ricinus communis RepID=B9S526_RICCO
SoyBase E_val: 1.00E-134 ISS
UniRef100_I1KZ93 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KZ93_SOYBN
SoyBase E_val: 4.00E-147 ISS
Expression Patterns of Glyma08g46850
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma08g46850 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g353900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g46850
Coding sequences of Glyma08g46850
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g46850.1 sequence type=CDS gene model=Glyma08g46850 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTTTCGGGGTCAGGAATCTGCGCGAAGAGGGTAGTTGTGGACGCGCGGCACCACATGCTGGGGAGGCTGGCATCGATCGTGGCGAAGGAACTTCTGAATGGGCAGAAGGTGGTGGTGGTGCGCTGCGAGGAGATTTGCATCTCCGGTGGGCTCGTCAGGCAGAAGATGAAGTACTTGCGTTTCCTCCGCAAGCGCATGAACACCAAGCCCTCTCACGGCCCCATCCATTTCCGTGCACCCGGCAAGATCTTCTGGCGCACCGTTCGTGGGATGATACCACACAAGACAAAGCGCGGGGAAGCTGCTCTTGCACGACTGAAGGTGTACGAGGGCATTCCTCCTCCTTATGACAAGACCAAGAGGATGGTTGTCCCTGATGCTCTCAAGGTGTTGAGGCTTCAGAAGGGACACAAATACTGTCATCTGGGCCAATTGTCATCTGAGGTTGGATGGAACTACTATGATACCATCAGGGAACTTGAGAAGAAAAGGAAGGAGAGAGCACAATTGTGTTATGAGAGGAAGAAGCAACTTGCCAAATTGAGGGTGAAAGCTGAGAAGGTTGCAGAGGAGAAGCTTGGTTCCCAAATTGAAATCCTTGCTCCTGTTAAGTATTAA
Predicted protein sequences of Glyma08g46850
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g46850.1 sequence type=predicted peptide gene model=Glyma08g46850 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKTKRMVVPDALKVLRLQKGHKYCHLGQLSSEVGWNYYDTIRELEKKRKERAQLCYERKKQLAKLRVKAEKVAEEKLGSQIEILAPVKY*