SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g46495

Feature Type:gene_model
Chromosome:Gm08
Start:45574053
stop:45576263
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g46495
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G13080AT Annotation by Michelle Graham. TAIR10: xyloglucan endotransglucosylase/hydrolase 1 | chr4:7626612-7628367 REVERSE LENGTH=292 SoyBaseE_val: 3.00E-37ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0006073GO-bp Annotation by Michelle Graham. GO Biological Process: cellular glucan metabolic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0016762GO-mf Annotation by Michelle Graham. GO Molecular Function: xyloglucan:xyloglucosyl transferase activity SoyBaseN/AISS
GO:0016798GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on glycosyl bonds SoyBaseN/AISS
PF00722PFAM Glycosyl hydrolases family 16 JGI ISS
PF06955PFAM Xyloglucan endo-transglycosylase (XET) C-terminus JGI ISS
UniRef100_Q9SV60UniRef Annotation by Michelle Graham. Most informative UniRef hit: Xyloglucan endotransglucosylase/hydrolase protein 2 n=1 Tax=Arabidopsis thaliana RepID=XTH2_ARATH SoyBaseE_val: 3.00E-34ISS
UniRef100_UPI0002339254UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339254 related cluster n=1 Tax=unknown RepID=UPI0002339254 SoyBaseE_val: 9.00E-154ISS

Expression Patterns of Glyma08g46495
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g46495 not represented in the dataset
Glyma08g46495 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g46495 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g350500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g46495
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g46495
>Glyma08g46495.1   sequence type=CDS   gene model=Glyma08g46495   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCACAAGAAACGGGCCACACAAAAATATAGTGGTGTGTTTATTTGACATAATGGCTCATCTGCACAAGCAACAAAACTTCTGCTTTGTCCTTCTATTTGTGGCACTGACCATAGCTTATGCTAGAAAAGCAATTGAAGTTAGCTTCCAACAGAACTACAAGGTTGTATGGGGAAAGCATCACGTCTTCTTTGTACAGCATGGTAGAGAAGTTCAACTCTCAATTGATAAGACTTCAGGGGCTGGCTTCAGATCAAAATTGGAATATGCTTCTGGATTCTTCCAAATGAGAATAAAGATACCCAACAAGGACACACACACACACACATTTTACGTGGATGAAATACCAATTGGAGTATTCAAGAACTACTCCAACGTGGAAGTGAGTTTTCCTTCAAAACAAATGCACGTTACGGCTAGCATATGGAATGGTGAACCTTGGGCATCTAATGGGAAGAGAATTGACTGGAAGCAAGCACCCTTCACTGCTCAGTTTCAAGGTTTCAACATTCATGGCTGCCGAACCCAAAATCGCAAAAAACATGCCTGCTATTCTCCTTATTTATGGTGGAATGACAAAAGACATTGGGAACTAAACCCTCAACAGCAGAGAGCGTATGAAGATGTGGGGAAGAAACATTTGTTGTATGACTACTGTTCTGATAGAGCCATAGAGGAGAATTGCACCAAGAATGTCAAATTAATTAGGTCATTAATTAATTGA
Predicted protein sequences of Glyma08g46495
>Glyma08g46495.1   sequence type=predicted peptide   gene model=Glyma08g46495   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MITRNGPHKNIVVCLFDIMAHLHKQQNFCFVLLFVALTIAYARKAIEVSFQQNYKVVWGKHHVFFVQHGREVQLSIDKTSGAGFRSKLEYASGFFQMRIKIPNKDTHTHTFYVDEIPIGVFKNYSNVEVSFPSKQMHVTASIWNGEPWASNGKRIDWKQAPFTAQFQGFNIHGCRTQNRKKHACYSPYLWWNDKRHWELNPQQQRAYEDVGKKHLLYDYCSDRAIEENCTKNVKLIRSLIN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo