Glyma08g46410 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g46410

Feature Type:	gene_model
Chromosome:	Gm08
Start:	45523024
stop:	45527511
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g46410

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G07190	AT	Annotation by Michelle Graham. TAIR10: B-cell receptor-associated protein 31-like \| chr3:2285979-2287155 REVERSE LENGTH=220	SoyBase	E_val: 5.00E-99	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG1962	KOG	B-cell receptor-associated protein and related proteins	JGI		ISS
PTHR12701	Panther	BCR-ASSOCIATED PROTEIN, BAP	JGI		ISS
PTHR12701:SF1	Panther	B-CELL RECEPTOR-ASSOCIATED PROTEIN 31RELATED	JGI		ISS
PF05266	PFAM	Protein of unknown function (DUF724)	JGI		ISS
PF05529	PFAM	B-cell receptor-associated protein 31-like	JGI		ISS
UniRef100_B9S4Z8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Bcr-associated protein, bap, putative n=1 Tax=Ricinus communis RepID=B9S4Z8_RICCO	SoyBase	E_val: 2.00E-116	ISS
UniRef100_I1KZ52	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KZ52_SOYBN	SoyBase	E_val: 2.00E-151	ISS

Expression Patterns of Glyma08g46410

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g46410

Paralog	Evidence	Comments
Glyma18g35976	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g46410 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g349600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g46410

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g46410

Limit To All Plant Sequences

>Glyma08g46410.1   sequence type=CDS   gene model=Glyma08g46410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTCAGTTGTTGTTCTTGGTGATTTTTGTTGAGGGGGTTCTGGCATTTCTTTTGTTGGTGAAGATAGGACCTTTGAGAGATCTTGTGATAAAGAGCCTGGATCAGTTGAAGATGGGGAAGGGTCCAGCTACAGTGAAAACCATTGCTGGTACCATGTCTGTGATTCTTCTTTCAAGTCTCATGAGCATTATCAAGATCCAGAACAAAGGTGCTAAACTCGGTACTATGTCGCCCATGGATCAAGTTCTATGGAGATCTCACTTGCTCGAGGCTTCACTCATGGGTTTTACATTATTCCTTGGATTCCTAATTGATCGTACCCACCATTATCTTCAAAAACTTATTAATTTAAGGAGTAATGCGGGAGCTTCAAAAGAAGAATTGGAAAACCTTAAAAAAGAAACTGTCCAACTTAAAGAAAAGGATGAGAAAGCATCCAAGGAGATTAAACAGCTAAAGGAAGAACTTTCATGTCTGTCCAAAAGTTTGGAAAAGATTAAATCGGAATCTGAAGAGAAGGATAAGAAAGTCGAGACCGCCGAAGCACATGTTGCTTCCCTCCAAAAGCAAGCTGCAGATCTACTACTTGAATATGATAGACTCTTAGAAGAAAACCAAAACCTTCAGGCTCAAACACTGGGACATAAGAGTTGA

Predicted protein sequences of Glyma08g46410

Limit To All Plant Sequences

>Glyma08g46410.1   sequence type=predicted peptide   gene model=Glyma08g46410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIQLLFLVIFVEGVLAFLLLVKIGPLRDLVIKSLDQLKMGKGPATVKTIAGTMSVILLSSLMSIIKIQNKGAKLGTMSPMDQVLWRSHLLEASLMGFTLFLGFLIDRTHHYLQKLINLRSNAGASKEELENLKKETVQLKEKDEKASKEIKQLKEELSCLSKSLEKIKSESEEKDKKVETAEAHVASLQKQAADLLLEYDRLLEENQNLQAQTLGHKS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain