SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 156 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g46410): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g46410): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g46410

Feature Type:gene_model
Chromosome:Gm08
Start:45523024
stop:45527511
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G07190AT Annotation by Michelle Graham. TAIR10: B-cell receptor-associated protein 31-like | chr3:2285979-2287155 REVERSE LENGTH=220 SoyBaseE_val: 5.00E-99ISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG1962 KOG B-cell receptor-associated protein and related proteins JGI ISS
PTHR12701Panther BCR-ASSOCIATED PROTEIN, BAP JGI ISS
PTHR12701:SF1Panther B-CELL RECEPTOR-ASSOCIATED PROTEIN 31RELATED JGI ISS
PF05266PFAM Protein of unknown function (DUF724) JGI ISS
PF05529PFAM B-cell receptor-associated protein 31-like JGI ISS
UniRef100_B9S4Z8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Bcr-associated protein, bap, putative n=1 Tax=Ricinus communis RepID=B9S4Z8_RICCO SoyBaseE_val: 2.00E-116ISS
UniRef100_I1KZ52UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KZ52_SOYBN SoyBaseE_val: 2.00E-151ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g46410 not represented in the dataset

Glyma08g46410 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g35976 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g349600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g46410.1   sequence type=CDS   gene model=Glyma08g46410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTCAGTTGTTGTTCTTGGTGATTTTTGTTGAGGGGGTTCTGGCATTTCTTTTGTTGGTGAAGATAGGACCTTTGAGAGATCTTGTGATAAAGAGCCTGGATCAGTTGAAGATGGGGAAGGGTCCAGCTACAGTGAAAACCATTGCTGGTACCATGTCTGTGATTCTTCTTTCAAGTCTCATGAGCATTATCAAGATCCAGAACAAAGGTGCTAAACTCGGTACTATGTCGCCCATGGATCAAGTTCTATGGAGATCTCACTTGCTCGAGGCTTCACTCATGGGTTTTACATTATTCCTTGGATTCCTAATTGATCGTACCCACCATTATCTTCAAAAACTTATTAATTTAAGGAGTAATGCGGGAGCTTCAAAAGAAGAATTGGAAAACCTTAAAAAAGAAACTGTCCAACTTAAAGAAAAGGATGAGAAAGCATCCAAGGAGATTAAACAGCTAAAGGAAGAACTTTCATGTCTGTCCAAAAGTTTGGAAAAGATTAAATCGGAATCTGAAGAGAAGGATAAGAAAGTCGAGACCGCCGAAGCACATGTTGCTTCCCTCCAAAAGCAAGCTGCAGATCTACTACTTGAATATGATAGACTCTTAGAAGAAAACCAAAACCTTCAGGCTCAAACACTGGGACATAAGAGTTGA

>Glyma08g46410.1   sequence type=predicted peptide   gene model=Glyma08g46410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIQLLFLVIFVEGVLAFLLLVKIGPLRDLVIKSLDQLKMGKGPATVKTIAGTMSVILLSSLMSIIKIQNKGAKLGTMSPMDQVLWRSHLLEASLMGFTLFLGFLIDRTHHYLQKLINLRSNAGASKEELENLKKETVQLKEKDEKASKEIKQLKEELSCLSKSLEKIKSESEEKDKKVETAEAHVASLQKQAADLLLEYDRLLEENQNLQAQTLGHKS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo