SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g46330

Feature Type:gene_model
Chromosome:Gm08
Start:45478130
stop:45482910
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g46330
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G48140AT Annotation by Michelle Graham. TAIR10: dolichol-phosphate mannosyltransferase-related | chr1:17783402-17783914 FORWARD LENGTH=89 SoyBaseE_val: 3.00E-48ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0033185GO-cc Annotation by Michelle Graham. GO Cellular Compartment: dolichol-phosphate-mannose synthase complex SoyBaseN/AISS
GO:0004582GO-mf Annotation by Michelle Graham. GO Molecular Function: dolichyl-phosphate beta-D-mannosyltransferase activity SoyBaseN/AISS
PTHR16433Panther DOLICHYL-PHOSPHATE MANNOSYLTRANSFERASE POLYPEPTIDE 3 JGI ISS
PF08285PFAM Dolichol-phosphate mannosyltransferase subunit 3 (DPM3) JGI ISS
UniRef100_I1KZ46UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KZ46_SOYBN SoyBaseE_val: 6.00E-57ISS
UniRef100_Q8LEQ4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dolichyl-phosphate mannosyltransferase polypeptide 3 n=1 Tax=Arabidopsis thaliana RepID=Q8LEQ4_ARATH SoyBaseE_val: 1.00E-45ISS

Expression Patterns of Glyma08g46330
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g46330
ParalogEvidenceComments
Glyma18g36160 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g46330 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g349000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g46330
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g46330
>Glyma08g46330.1   sequence type=CDS   gene model=Glyma08g46330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCATATTGTGAAGATTTTGACATTGGTAATGGCCATTACTGCGTTATGGGTTGGCCTTCTACAAACTTCTATGATTCCATGCAGCCATACTTGGTTGTTACCCATATATTTTGTTGTGTCTTTAGGATGTTATGGTCTTTTAATGGTTGGAGTTGGTCTGATGAATTTTCCAACCTGTCCTCAAGAAGCTCTATTATTGCAGAAGGACATTGTTGAGGCCAAGGAATATCTGAAACAAAAAGGAGTTGATGTTAGTTCCAGTTGA
Predicted protein sequences of Glyma08g46330
>Glyma08g46330.1   sequence type=predicted peptide   gene model=Glyma08g46330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKHIVKILTLVMAITALWVGLLQTSMIPCSHTWLLPIYFVVSLGCYGLLMVGVGLMNFPTCPQEALLLQKDIVEAKEYLKQKGVDVSSS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo