SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g46240

Feature Type:gene_model
Chromosome:Gm08
Start:45408194
stop:45409955
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g46240
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G07230AT Annotation by Michelle Graham. TAIR10: wound-responsive protein-related | chr3:2299920-2300183 FORWARD LENGTH=46 SoyBaseE_val: 5.00E-16ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF08186PFAM Wound-inducible basic protein family JGI ISS
UniRef100_I1KZ37UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KZ37_SOYBN SoyBaseE_val: 1.00E-34ISS
UniRef100_Q09020UniRef Annotation by Michelle Graham. Most informative UniRef hit: Wound-induced basic protein n=1 Tax=Phaseolus vulgaris RepID=PR4_PHAVU SoyBaseE_val: 3.00E-19ISS

Expression Patterns of Glyma08g46240
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g46240
ParalogEvidenceComments
Glyma18g33345 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g46240 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g348200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g46240
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g46240
>Glyma08g46240.1   sequence type=CDS   gene model=Glyma08g46240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTTACGACGTTAACTCTCCTCTTTTCCGATCCTTCCTCAGCCAGAAGGGAGGCTCCTCTGATAAGAGGTTTTCCCCCCCTCTATTTCTCTCTTGTCAATCGTTGGGGAAATCGGACGAACAGAAGCCAAAAGAGCAGAAACCCAAAGCCAGCGAGAACAAACCTATAATGACTGAGTGA
Predicted protein sequences of Glyma08g46240
>Glyma08g46240.1   sequence type=predicted peptide   gene model=Glyma08g46240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIYDVNSPLFRSFLSQKGGSSDKRFSPPLFLSCQSLGKSDEQKPKEQKPKASENKPIMTE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo