Glyma08g46070 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g46070): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g46070): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g46070

Feature Type:	gene_model
Chromosome:	Gm08
Start:	45285631
stop:	45288217
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g46070

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G59240	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein S8e family protein \| chr5:23902626-23903670 REVERSE LENGTH=210	SoyBase	E_val: 5.00E-123	ISS
GO:0000462	GO-bp	Annotation by Michelle Graham. GO Biological Process: maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0006414	GO-bp	Annotation by Michelle Graham. GO Biological Process: translational elongation	SoyBase	N/A	ISS
GO:0009165	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0042254	GO-bp	Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis	SoyBase	N/A	ISS
GO:0042991	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription factor import into nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0022627	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG3283	KOG	40S ribosomal protein S8	JGI		ISS
PTHR10394	Panther	40S RIBOSOMAL PROTEIN S8	JGI		ISS
PF01201	PFAM	Ribosomal protein S8e	JGI		ISS
UniRef100_C6T968	UniRef	Annotation by Michelle Graham. Best UniRef hit: 40S ribosomal protein S8 n=1 Tax=Glycine max RepID=C6T968_SOYBN	SoyBase	E_val: 1.00E-155	ISS
UniRef100_C6T968	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S8 n=1 Tax=Glycine max RepID=C6T968_SOYBN	SoyBase	E_val: 1.00E-155	ISS

Expression Patterns of Glyma08g46070

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g46070 not represented in the dataset	Glyma08g46070 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g46070

Paralog	Evidence	Comments
Glyma18g32680	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g46070 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g346500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g46070

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g46070

Limit To All Plant Sequences

>Glyma08g46070.1   sequence type=CDS   gene model=Glyma08g46070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTATTTCTAGGGATTCCATGCACAAGAGGCGTGCCACTGGTGGCAAGAAAAAGGCTTGGAGAAAGAAGAGAAAGTATGAGCTTGGGCGTCAGGCAGCAAACACCAAGTTATCAAGCAACAAGACAATCAGGAGGATTCGTGTTAGAGGTGGCAATGTTAAATGGAGGGCATTGAGGCTGGATACTGGCAATTACTCATGGGGTAGTGAAGCAGTTACTCGCAAGACTCGTATTCTAGATGTTGTTTACAATGCCTCAAACAACGAGCTTGTGCGAACTCAGACCCTGGTCAAGAGTGCTATTGTCCAGGTTGATGCTGCTCCTTTCAGGCAGTGGTACCTTCAGCACTATGGTGTTGAAATTGGTAGAAAAAAGAAAGTGGCAGCCAAGAAGGATTCTACTGAGGAAGGTGAGGCTGCTGCTGAAGAAACTAAGAAAAGTAACCATGTGCAGAGAAAACTTGAGAAACGCCAGAAAGATCGTAATCTTGACTCCCACATTGAAGAGCAATTTGGTGGTGGGCGATTGTTGGCCTGTATTTCTTCTCGTCCCGGACAATGTGGCAGGGCTGATGGGTACATTCTTGAAGGTAAGGAGCTGGAGTTTTACATGAAGAAACTCCAGAGGAAGAAGGGAAAGGGTGCTGCTTAA

Predicted protein sequences of Glyma08g46070

Limit To All Plant Sequences

>Glyma08g46070.1   sequence type=predicted peptide   gene model=Glyma08g46070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYGVEIGRKKKVAAKKDSTEEGEAAAEETKKSNHVQRKLEKRQKDRNLDSHIEEQFGGGRLLACISSRPGQCGRADGYILEGKELEFYMKKLQRKKGKGAA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain