SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g45920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g45920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g45920

Feature Type:gene_model
Chromosome:Gm08
Start:45173314
stop:45177284
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G07410AT Annotation by Michelle Graham. TAIR10: RAB GTPase homolog A5B | chr3:2372485-2373482 REVERSE LENGTH=217 SoyBaseE_val: 2.00E-123ISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0009855GO-bp Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry SoyBaseN/AISS
GO:0009944GO-bp Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis SoyBaseN/AISS
GO:0010014GO-bp Annotation by Michelle Graham. GO Biological Process: meristem initiation SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG0087 KOG GTPase Rab11/YPT3, small G protein superfamily JGI ISS
PTHR24073Panther FAMILY NOT NAMED JGI ISS
PTHR24073:SF213Panther SUBFAMILY NOT NAMED JGI ISS
PF00071PFAM Ras family JGI ISS
UniRef100_G3ECQ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Rfls8 protein n=1 Tax=Glycine max RepID=G3ECQ7_SOYBN SoyBaseE_val: 3.00E-152ISS
UniRef100_G3ECQ7UniRef Annotation by Michelle Graham. Best UniRef hit: Rfls8 protein n=1 Tax=Glycine max RepID=G3ECQ7_SOYBN SoyBaseE_val: 3.00E-152ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g45920 not represented in the dataset

Glyma08g45920 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g345300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g45920.1   sequence type=CDS   gene model=Glyma08g45920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGAGAACGGTGAAGGCGGCGAGGAGTACCTGTTCAAGATAGTGCTGATTGGGGACTCCGCGGTGGGGAAGTCCAACCTCCTCTCGCGGTTCGCGCGGAACGAGTTCGATAGCAACTCCAAGGCCACCATTGGGGTCGAGTTCCAGACGCAGCTCGTCGAGATCGACGGCAAAGAGATCAAGGCGCAGATCTGGGACACTGCGGGACAAGAGAGGTTTCGAGCTGTCACCTCTGCTTACTACAGAGGCGCTGTTGGTGCGCTCGTTGTTTACGATATCAGCAGGAGGGGCACCTTCGACAGCATCAAGCGATGGCTCCAAGAACTCACTACTCAAAATGATAGCACCGTAGCAAGAATGTTGGTGGGAAATAAATGTGACTTGGAGAATATTAGAGAGGTGAGCACAGAAGAGGGCAAAAGTCTTGCAGAAGAAGAAGGTTTGTTCTTTATGGAGACATCTGCACTCGATGCTACCAATGTCCAAACAGCTTTTGAGATTGTTATCCGCGAAATTTACAACAACATCAGCCGTAAAGTCTTGAACTCTGACTCTTATAAGGCTGAGTTGTCTGTGAATCGAGTAAGCCTAGTTAATGGTGCAGGATCAAAGCAAGGTCCTTCTTGTTGTTCTCGATGA

>Glyma08g45920.1   sequence type=predicted peptide   gene model=Glyma08g45920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAENGEGGEEYLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQLVEIDGKEIKAQIWDTAGQERFRAVTSAYYRGAVGALVVYDISRRGTFDSIKRWLQELTTQNDSTVARMLVGNKCDLENIREVSTEEGKSLAEEEGLFFMETSALDATNVQTAFEIVIREIYNNISRKVLNSDSYKAELSVNRVSLVNGAGSKQGPSCCSR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo