SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g45890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g45890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g45890

Feature Type:gene_model
Chromosome:Gm08
Start:45153248
stop:45154896
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G12970AT Annotation by Michelle Graham. TAIR10: stomagen | chr4:7586244-7586798 REVERSE LENGTH=102 SoyBaseE_val: 1.00E-28ISS
GO:0007267GO-bp Annotation by Michelle Graham. GO Biological Process: cell-cell signaling SoyBaseN/AISS
GO:0010375GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal complex patterning SoyBaseN/AISS
GO:0016556GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA modification SoyBaseN/AISS
GO:2000038GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of stomatal complex development SoyBaseN/AISS
GO:2000123GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of stomatal complex development SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G7KY15UniRef Annotation by Michelle Graham. Most informative UniRef hit: EPIDERMAL PATTERNING FACTOR-like protein n=1 Tax=Medicago truncatula RepID=G7KY15_MEDTR SoyBaseE_val: 1.00E-46ISS
UniRef100_I1KYZ9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KYZ9_SOYBN SoyBaseE_val: 1.00E-126ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g45890 not represented in the dataset

Glyma08g45890 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g345100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g45890.1   sequence type=CDS   gene model=Glyma08g45890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCCTCTGTCTCACTGCACATTTTGGCAGTCTATTATCTCTTATGGTCATTAATTCACCACAACACCGTTATCTCTCTCTCTCTCTCTCTCCTTCAACCCTTCCACTCATCTTTATCCTTTCCACAAACTCATATTTATCCCTTAAATACATTCACCATCAACACTCTTACCTTCAAAGTTGTTATTGCAACACAAAAGTGGAAAGAATGAGAGACACAAAACTACCTGAAGTAGTATTCTTGCTACTCTTCACCTTAATTCTTGCATCTAAATTTACGCAAGGAATTAGAACAGAAGAATCGGTATCTCAATCCCCTCAACCCCAAAGAGAACCAAGTTTGGAGGATGGCAATGAGGCATGGAAAATGAGGAATTCTAGGAGACTAATGATTGGATCCACTGCACCAACTTGTACGTACAATGAATGTAGAGGTTGTAAGTATAAATGCAGAGCTGAGCAAGTGCCTGTAGAGGGAAATGACCCAATTAATAGCCCATACCACTACAGATGTGTTTGTCATAGATGA

>Glyma08g45890.1   sequence type=predicted peptide   gene model=Glyma08g45890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLLCLTAHFGSLLSLMVINSPQHRYLSLSLSPSTLPLIFILSTNSYLSLKYIHHQHSYLQSCYCNTKVERMRDTKLPEVVFLLLFTLILASKFTQGIRTEESVSQSPQPQREPSLEDGNEAWKMRNSRRLMIGSTAPTCTYNECRGCKYKCRAEQVPVEGNDPINSPYHYRCVCHR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo