SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g45880

Feature Type:gene_model
Chromosome:Gm08
Start:45138185
stop:45140640
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g45880
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G25400AT Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: NTP Pyrophosphohydrolase MazG-related, RS21-C6 (InterPro:IPR011394), EAR (InterPro:IPR009039), NTP pyrophosphohydrolase MazG, putative catalytic core (InterPro:IPR004518); Has 1123 Blast hits to 1121 proteins in 452 species: Archae - 22; Bacteria - 753; Metazoa - 81; Fungi - 3; Plants - 83; Viruses - 0; Other Eukaryotes - 181 (source: NCBI BLink). | chr3:9213236-9214144 FORWARD LENGTH=141 SoyBaseE_val: 2.00E-58ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR14552Panther FAMILY NOT NAMED JGI ISS
PTHR14552:SF4Panther OS02G0479300 PROTEIN JGI ISS
PF03819PFAM MazG nucleotide pyrophosphohydrolase domain JGI ISS
UniRef100_C6T106UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T106_SOYBN SoyBaseE_val: 6.00E-103ISS
UniRef100_G7KY22UniRef Annotation by Michelle Graham. Most informative UniRef hit: dCTP pyrophosphatase n=1 Tax=Medicago truncatula RepID=G7KY22_MEDTR SoyBaseE_val: 3.00E-65ISS

Expression Patterns of Glyma08g45880
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g45880 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g345000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g45880
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g45880
>Glyma08g45880.1   sequence type=CDS   gene model=Glyma08g45880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCGGTGTTGCTGATGAAGCCCCCGTTACCCTCGACACGCTGAAGCAATTAATGGCTCAGTTCGCCAAAGAGAGAGACTGGGACCGTTTTCACAGCCCAAGAAACCTTCTTTTGGCTCTGGTGGGTGAAGTAGGAGAATTGTCTGAGATATTTCAGTGGAAAGGTGAGGTTCCAAAGGGTCTTCCAGATTGGAAAGAGGAGGAAAAGGTTCATCTTGGGGAAGAGCTTTCTGATGTGTTGCTTTACCTTGTCAGGCTCTCTGACATTTGTGGCGTTGATCTTGGTAAAGCTGCTTTACGAAAGGTTCAACTCAATGCCATCAAATATCCTGCAAAAGTTTGCAAAGAGGAGGAGGTGGTGGTTTCAATTTCAAGCAACCAAGAGGAAGAAAAAAACCCTTCCACCAATAATAATGGCACTGCCACTGAATCTGATGCTGACTGA
Predicted protein sequences of Glyma08g45880
>Glyma08g45880.1   sequence type=predicted peptide   gene model=Glyma08g45880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTGVADEAPVTLDTLKQLMAQFAKERDWDRFHSPRNLLLALVGEVGELSEIFQWKGEVPKGLPDWKEEEKVHLGEELSDVLLYLVRLSDICGVDLGKAALRKVQLNAIKYPAKVCKEEEVVVSISSNQEEEKNPSTNNNGTATESDAD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo