Report for Sequence Feature Glyma08g45830
Feature Type: gene_model
Chromosome: Gm08
Start: 45098876
stop: 45101479
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g45830
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G48500 AT
Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G10930.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:19653235-19654017 FORWARD LENGTH=167
SoyBase E_val: 2.00E-33 ISS
GO:0080167 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to karrikin
SoyBase N/A ISS
GO:0005575 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cellular component
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_Q9LV64 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Gb|AAD28645.1 n=1 Tax=Arabidopsis thaliana RepID=Q9LV64_ARATH
SoyBase E_val: 4.00E-28 ISS
UniRef100_UPI0002339291 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI0002339291 related cluster n=1 Tax=unknown RepID=UPI0002339291
SoyBase E_val: 1.00E-105 ISS
Expression Patterns of Glyma08g45830
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g45830
Paralog Evidence Comments
Glyma18g26140 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g45830 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g344400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g45830
Coding sequences of Glyma08g45830
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g45830.2 sequence type=CDS gene model=Glyma08g45830 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAAGAATGGTACTACAAGAAGAGCCAAGTGCCAGCATTTGGGAGTTGGGATTGGAACGATAACCTACCTTTCACACAGTGCTTCGAGTCAGCGAGGCAAGCTGGTTTGCTACGATGTAGTAATTACTCTGAGTCTGAGGAACGTGACCTTTATGTTACAGGGGATTTGTACGAGAATAATGTTGTCACACCCGCCATGATCGTTGTTCCTCGCAGAAGGGCAAATGTGGTTGACCAGCATGAAAAAGAAACGAAATTAAAGAATTGGATCAGTGATGATGTGGATAGTGAATCACCCAGCCCAACTCCACTGCCAAGGCCAACTTCAAAACCCGTTGATGAGGACTTGTACAAGATCTCACCGGGGCTTGTTTATGCCAAAGCTAAAAAGAAGAGAGGGTTGTGCTTCTTTTCTAGTTGCTTGTTACCAACTTGCATCGCTTGA
Predicted protein sequences of Glyma08g45830
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g45830.2 sequence type=predicted peptide gene model=Glyma08g45830 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEEWYYKKSQVPAFGSWDWNDNLPFTQCFESARQAGLLRCSNYSESEERDLYVTGDLYENNVVTPAMIVVPRRRANVVDQHEKETKLKNWISDDVDSESPSPTPLPRPTSKPVDEDLYKISPGLVYAKAKKKRGLCFFSSCLLPTCIA*