SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g45780

Feature Type:gene_model
Chromosome:Gm08
Start:45048647
stop:45050888
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g45780
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G07460AT Annotation by Michelle Graham. TAIR10: Protein of unknown function, DUF538 | chr3:2384837-2385617 REVERSE LENGTH=177 SoyBaseE_val: 1.00E-46ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF04398PFAM Protein of unknown function, DUF538 JGI ISS
UniRef100_G7KZ44UniRef Annotation by Michelle Graham. Most informative UniRef hit: Eukaryotic translation initiation factor 3 subunit A n=1 Tax=Medicago truncatula RepID=G7KZ44_MEDTR SoyBaseE_val: 4.00E-65ISS
UniRef100_I1KYY5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KYY5_SOYBN SoyBaseE_val: 5.00E-133ISS

Expression Patterns of Glyma08g45780
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g45780
ParalogEvidenceComments
Glyma18g26180 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g45780 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g343900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g45780
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g45780
>Glyma08g45780.1   sequence type=CDS   gene model=Glyma08g45780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTTCCTTCCCTCACACCATCATCTTCATCCTTGTCTTTCCAATCATTATTTCTTGCTCCTGGGCCTCGTCGTTGGGCCTGAGTAGCAATGCGACGACCATCTACGAGGTCCTGAGCGAGCACGGGCTGCCCATGGGCCTGTTCCCGCAGGGCGTGCGGGAGTTCGCGGTGGGCGAGGATGGTAGCTTCTGGGTGCGCCTCGACGAGGCCTGCAACGCCAAGTTCGAGAACGAGCTGCATTACGAGCGCAACGTCTCCGGCCACCTCAGCTACGGCATGATCGACGCCCTCTCCGGCCTCGAGGCCCAGGATCTCTTCCTCTGGTTCCAGGTCATGAGTATCCGCGTCGACGTCCCCAGCACCGGCCTCATCTACTTCGACGTCGGCGCCGCCTCCAAGCGCTTCCCCTTGTCCCTCTTCGAAACCCCGCCCGAATGCGTCGCCGTTCGCTCCCAACAACAGGACGCCCCTTCCCACCACCAGGGTCAGGTTCAATCTGGAAGGCTTCGGTATAAGCTCAAACAGGGAACCTCTGGAAGAGATGTTCTATAG
Predicted protein sequences of Glyma08g45780
>Glyma08g45780.1   sequence type=predicted peptide   gene model=Glyma08g45780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFSFPHTIIFILVFPIIISCSWASSLGLSSNATTIYEVLSEHGLPMGLFPQGVREFAVGEDGSFWVRLDEACNAKFENELHYERNVSGHLSYGMIDALSGLEAQDLFLWFQVMSIRVDVPSTGLIYFDVGAASKRFPLSLFETPPECVAVRSQQQDAPSHHQGQVQSGRLRYKLKQGTSGRDVL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo