Report for Sequence Feature Glyma08g45770
Feature Type: gene_model
Chromosome: Gm08
Start: 45041642
stop: 45044751
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g45770
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G10360 AT
Annotation by Michelle Graham. TAIR10: Ribosomal protein S6e | chr5:3258734-3260142 REVERSE LENGTH=249
SoyBase E_val: 9.00E-162 ISS
GO:0006364 GO-bp
Annotation by Michelle Graham. GO Biological Process: rRNA processing
SoyBase N/A ISS
GO:0006412 GO-bp
Annotation by Michelle Graham. GO Biological Process: translation
SoyBase N/A ISS
GO:0009793 GO-bp
Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy
SoyBase N/A ISS
GO:0040007 GO-bp
Annotation by Michelle Graham. GO Biological Process: growth
SoyBase N/A ISS
GO:0042274 GO-bp
Annotation by Michelle Graham. GO Biological Process: ribosomal small subunit biogenesis
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0005840 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: ribosome
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0009506 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma
SoyBase N/A ISS
GO:0022626 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome
SoyBase N/A ISS
GO:0022627 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit
SoyBase N/A ISS
GO:0003735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome
SoyBase N/A ISS
KOG1646
KOG
40S ribosomal protein S6
JGI ISS
PTHR11502 Panther
40S RIBOSOMAL PROTEIN S6
JGI ISS
PF01092 PFAM
Ribosomal protein S6e
JGI ISS
UniRef100_I1KYY4 UniRef
Annotation by Michelle Graham. Best UniRef hit: 40S ribosomal protein S6 n=1 Tax=Glycine max RepID=I1KYY4_SOYBN
SoyBase E_val: 2.00E-177 ISS
UniRef100_I1KYY4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S6 n=1 Tax=Glycine max RepID=I1KYY4_SOYBN
SoyBase E_val: 2.00E-177 ISS
Expression Patterns of Glyma08g45770
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g45770
Paralog Evidence Comments
Glyma18g26190 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g45770 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g343800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g45770
Coding sequences of Glyma08g45770
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g45770.1 sequence type=CDS gene model=Glyma08g45770 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGTTCAACATCGCGAATCCCACCACTGGATGCCAGAAGAAGCTCGAGATCGACGACGATCTGAAACTGCGAGCATTTTGGGACAAGAGGATCTCACAGGAGGTCATCGGAGATGCACTCGGTGAGGAATTTAAGGGCTATGTCTTCAAAATTACCGGAGGTTGTGACAAACAAGGATTTCCAATGAAGCAGGGAGTGCTGACTCCTGGTCGTGTTAGACTTTTGCTTCACAGGGGAACTCCTTGCTTCCGTGGATATGGAAGGCGTAATGGAGAGCGTAGGAGAAAGTCTGTTCGTGGGTGCATTGTCAGCCCAGACCTCTCTGTTTTGAACTTGGTAATTGTGAAGAAAGGTGAGAATGATTTACCAGGATTGACTGATGTTGAGAAGCCAAGGATGAGAGGCCCAAAGAGAGCATCCAAAATCCGTAAACTGTTCAACCTGTCTAAGGAGGATGATGTTAGGAAGTATGTCAACACCTACCGTCGTACATTTACGACAAAAGCTGGGAAAAAGGTGAGCAAAGCTCCCAAGATACAAAGACTGGTCACTCCTCTTACGCTCCAAAGAAAGCGGGCAAGAATTGCTGATAAGAAGAAGAGGATTGCCAAGGCAAAATCTGAGGCAGCAGAGTACCAGAAACTCCTTGCCTCCAGGTTGAAGGAGCAGAGAGACCGCCGCAGTGAGAGTTTGGCCAAGAGGAGATCCAAGCTTTCCAGTGCTGCTAAGGCAGCAGCTGTATAA
Predicted protein sequences of Glyma08g45770
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g45770.1 sequence type=predicted peptide gene model=Glyma08g45770 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVIGDALGEEFKGYVFKITGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGENDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPKIQRLVTPLTLQRKRARIADKKKRIAKAKSEAAEYQKLLASRLKEQRDRRSESLAKRRSKLSSAAKAAAV*