Report for Sequence Feature Glyma08g45740
Feature Type: gene_model
Chromosome: Gm08
Start: 45029299
stop: 45034176
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g45740
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G29660 AT
Annotation by Michelle Graham. TAIR10: embryo defective 2752 | chr4:14534495-14535171 REVERSE LENGTH=103
SoyBase E_val: 1.00E-44 ISS
GO:0009793 GO-bp
Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_B6TQN4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: EMB2752 n=2 Tax=Andropogoneae RepID=B6TQN4_MAIZE
SoyBase E_val: 1.00E-41 ISS
UniRef100_I1KYY3 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KYY3_SOYBN
SoyBase E_val: 2.00E-63 ISS
Expression Patterns of Glyma08g45740
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g45740
Paralog Evidence Comments
Glyma18g26390 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g45740 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g343600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g45740
Coding sequences of Glyma08g45740
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g45740.1 sequence type=CDS gene model=Glyma08g45740 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCAAGCTACCTGTGGAGAAAATATGCAGATTATTTGTACACAAAGTGGGAAAAAACCTTTCTTTGGGACATGGTGGAACCTTACAGAAGGCCCAAATCCTTTACTCCATTGGTCACTATTTACATGGCTGCTTTCTACTCTGGAGTCATTGGTGCTGCCATCACTGAGCAACTCTACAAGGAAAAGTACTGGGAAGAGCACCCTGGGAAAGCAGTGCCTCTCATGAGACCAAAGTTTTATGGGGGTCCTTGGAGGGTCATGGGCGGTAATGAACCCCCATCCGAATGA
Predicted protein sequences of Glyma08g45740
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g45740.1 sequence type=predicted peptide gene model=Glyma08g45740 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MASYLWRKYADYLYTKWEKTFLWDMVEPYRRPKSFTPLVTIYMAAFYSGVIGAAITEQLYKEKYWEEHPGKAVPLMRPKFYGGPWRVMGGNEPPSE*