SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g45710

Feature Type:gene_model
Chromosome:Gm08
Start:44999040
stop:45000074
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g45710
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G07480AT Annotation by Michelle Graham. TAIR10: 2Fe-2S ferredoxin-like superfamily protein | chr3:2389026-2389505 FORWARD LENGTH=159 SoyBaseE_val: 7.00E-71ISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0051536GO-mf Annotation by Michelle Graham. GO Molecular Function: iron-sulfur cluster binding SoyBaseN/AISS
KOG3309 KOG Ferredoxin JGI ISS
PTHR23426Panther FERREDOXIN/ADRENODOXIN JGI ISS
PTHR23426:SF7Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_G7KWY5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ferredoxin n=1 Tax=Medicago truncatula RepID=G7KWY5_MEDTR SoyBaseE_val: 2.00E-77ISS
UniRef100_I1KYX9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KYX9_SOYBN SoyBaseE_val: 3.00E-111ISS

Expression Patterns of Glyma08g45710
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g45710 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g343100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g45710
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g45710
>Glyma08g45710.1   sequence type=CDS   gene model=Glyma08g45710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGTGGCGAATCTGCAGAGACTGTCCTCGCAAGTGCACCGCCTCCCCTCCGTCTCGTTCTTCTCCAAATCCCTGATCTCCCGCACCTCCACCTCTTCCTCCTCCACGAAGAAGGTCGCGGACCGCATCGTGCGGCTGTCGGCGATCGACTTCGCGGGTAAGAAGCACGAGGTGGTGGGCCTGGCCGGTCAGACCCTGCTGAAGGCGCTGATAAACACGGGCCTGGTCGACCCGGAGTCCCACCGCCTGGAGGAGATCGACGCCTGCGCGGCCCACTGCGAGGTCAACATCGCGCAGGAGTGGCTCGACAAGCTACCCCCTCGCTCCTACGACGAGGAGTACGTCCTCGTTCGCAATTCCCGAGCAAGGGTCCTCAACAAACACTCCAGGCTCGGATGCCAAGTTCTCCTCGACCACGACCTCGAAGGTATGGTCGTTGCCCTCCCCGAACCTAGGCCCTGGGACACTTCCTAA
Predicted protein sequences of Glyma08g45710
>Glyma08g45710.1   sequence type=predicted peptide   gene model=Glyma08g45710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVANLQRLSSQVHRLPSVSFFSKSLISRTSTSSSSTKKVADRIVRLSAIDFAGKKHEVVGLAGQTLLKALINTGLVDPESHRLEEIDACAAHCEVNIAQEWLDKLPPRSYDEEYVLVRNSRARVLNKHSRLGCQVLLDHDLEGMVVALPEPRPWDTS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo