Glyma08g45710 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g45710): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g45710): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g45710

Feature Type:	gene_model
Chromosome:	Gm08
Start:	44999040
stop:	45000074
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g45710

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G07480	AT	Annotation by Michelle Graham. TAIR10: 2Fe-2S ferredoxin-like superfamily protein \| chr3:2389026-2389505 FORWARD LENGTH=159	SoyBase	E_val: 7.00E-71	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0009853	GO-bp	Annotation by Michelle Graham. GO Biological Process: photorespiration	SoyBase	N/A	ISS
GO:0051788	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to misfolded protein	SoyBase	N/A	ISS
GO:0080129	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0051536	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron-sulfur cluster binding	SoyBase	N/A	ISS
KOG3309	KOG	Ferredoxin	JGI		ISS
PTHR23426	Panther	FERREDOXIN/ADRENODOXIN	JGI		ISS
PTHR23426:SF7	Panther	SUBFAMILY NOT NAMED	JGI		ISS
UniRef100_G7KWY5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ferredoxin n=1 Tax=Medicago truncatula RepID=G7KWY5_MEDTR	SoyBase	E_val: 2.00E-77	ISS
UniRef100_I1KYX9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KYX9_SOYBN	SoyBase	E_val: 3.00E-111	ISS

Expression Patterns of Glyma08g45710

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g45710 not represented in the dataset	Glyma08g45710 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g45710 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g343100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g45710

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g45710

Limit To All Plant Sequences

>Glyma08g45710.1   sequence type=CDS   gene model=Glyma08g45710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGTGGCGAATCTGCAGAGACTGTCCTCGCAAGTGCACCGCCTCCCCTCCGTCTCGTTCTTCTCCAAATCCCTGATCTCCCGCACCTCCACCTCTTCCTCCTCCACGAAGAAGGTCGCGGACCGCATCGTGCGGCTGTCGGCGATCGACTTCGCGGGTAAGAAGCACGAGGTGGTGGGCCTGGCCGGTCAGACCCTGCTGAAGGCGCTGATAAACACGGGCCTGGTCGACCCGGAGTCCCACCGCCTGGAGGAGATCGACGCCTGCGCGGCCCACTGCGAGGTCAACATCGCGCAGGAGTGGCTCGACAAGCTACCCCCTCGCTCCTACGACGAGGAGTACGTCCTCGTTCGCAATTCCCGAGCAAGGGTCCTCAACAAACACTCCAGGCTCGGATGCCAAGTTCTCCTCGACCACGACCTCGAAGGTATGGTCGTTGCCCTCCCCGAACCTAGGCCCTGGGACACTTCCTAA

Predicted protein sequences of Glyma08g45710

Limit To All Plant Sequences

>Glyma08g45710.1   sequence type=predicted peptide   gene model=Glyma08g45710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVANLQRLSSQVHRLPSVSFFSKSLISRTSTSSSSTKKVADRIVRLSAIDFAGKKHEVVGLAGQTLLKALINTGLVDPESHRLEEIDACAAHCEVNIAQEWLDKLPPRSYDEEYVLVRNSRARVLNKHSRLGCQVLLDHDLEGMVVALPEPRPWDTS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain