SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g45560

Feature Type:gene_model
Chromosome:Gm08
Start:44893151
stop:44894189
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g45560
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G73330AT Annotation by Michelle Graham. TAIR10: drought-repressed 4 | chr1:27569022-27569651 REVERSE LENGTH=209 SoyBaseE_val: 6.00E-11ISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0004866GO-mf Annotation by Michelle Graham. GO Molecular Function: endopeptidase inhibitor activity SoyBaseN/AISS
GO:0030414GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidase inhibitor activity SoyBaseN/AISS
PF00197PFAM Trypsin and protease inhibitor JGI ISS
UniRef100_I1KYX0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KYX0_SOYBN SoyBaseE_val: 2.00E-154ISS
UniRef100_Q9XIS8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Trypsin inhibitor p20 n=1 Tax=Glycine max RepID=Q9XIS8_SOYBN SoyBaseE_val: 5.00E-56ISS

Expression Patterns of Glyma08g45560
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g45560 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g341800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g45560
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g45560
>Glyma08g45560.1   sequence type=CDS   gene model=Glyma08g45560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAATACTATCTTCTCTGCTCTCTTTCTACTTTGTGCCTTCACCACCTCATACCTACCTTCAACCACCGCGGTGGTCGATACCAACGGTGATATTCTTCAGAATCCTGGCACATACTTTATCTTGTCCGTTTTTCGACCCGGCGGCGGAGTAGAATTCGCCGCCACTGGAAACGAAACTTGCCCTCTCACTGTTGTGCAGACTCTCTTCGGGAGGGGATTTCCAGTAATCTTATCGTCCCAGTTACGAATCCCTATCATCGGCGAAGGACAACTCTTCAGCATCCTGTTCCGTATTGTGCCATGGTGCGCCACCACTCCTTCTAAGTGGACCATTGTGGAGGGTTTACCAGAATCACCCGCGGTTAAACTCACTGGGTACGACAACACAGTGCCTGGTGAGTTTAAAATTGAGAAAGCTAACCCTTTCCATAACGACTATACCCTTTTGTTCTGTCCAGCTGGCGAAGAAAGCAAATGTGGGCATATTGGGATTCATTTCGATGATGATGGAAACAGGCGTTTGGTGGTGTCTGAGGAGAATATATTAAGGGTTCAGTTTCAGAAATTTGGATCATCAGCACCGGATGAGGCATCACTGGCCCTTAAAAAACATCATGTGCTCTCTGTCAGTGAGTGA
Predicted protein sequences of Glyma08g45560
>Glyma08g45560.1   sequence type=predicted peptide   gene model=Glyma08g45560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKNTIFSALFLLCAFTTSYLPSTTAVVDTNGDILQNPGTYFILSVFRPGGGVEFAATGNETCPLTVVQTLFGRGFPVILSSQLRIPIIGEGQLFSILFRIVPWCATTPSKWTIVEGLPESPAVKLTGYDNTVPGEFKIEKANPFHNDYTLLFCPAGEESKCGHIGIHFDDDGNRRLVVSEENILRVQFQKFGSSAPDEASLALKKHHVLSVSE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo