Glyma08g45190 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g45190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g45190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g45190

Feature Type:	gene_model
Chromosome:	Gm08
Start:	44614545
stop:	44615366
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g45190

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G04950	AT	Annotation by Michelle Graham. TAIR10: thioredoxin family protein \| chr4:2517882-2519924 REVERSE LENGTH=488	SoyBase	E_val: 3.00E-76	ISS
GO:0000280	GO-bp	Annotation by Michelle Graham. GO Biological Process: nuclear division	SoyBase	N/A	ISS
GO:0007000	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleolus organization	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0009926	GO-bp	Annotation by Michelle Graham. GO Biological Process: auxin polar transport	SoyBase	N/A	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0051726	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle	SoyBase	N/A	ISS
GO:0072593	GO-bp	Annotation by Michelle Graham. GO Biological Process: reactive oxygen species metabolic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0015035	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity	SoyBase	N/A	ISS
PTHR10293	Panther	GLUTAREDOXIN	JGI		ISS
PTHR10293:SF17	Panther	GLUTAREDOXIN-RELATED	JGI		ISS
PF00462	PFAM	Glutaredoxin	JGI		ISS
UniRef100_G7ZZ90	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Monothiol glutaredoxin-S17 n=1 Tax=Medicago truncatula RepID=G7ZZ90_MEDTR	SoyBase	E_val: 2.00E-94	ISS
UniRef100_UPI00023390D8	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023390D8 related cluster n=1 Tax=unknown RepID=UPI00023390D8	SoyBase	E_val: 2.00E-126	ISS

Expression Patterns of Glyma08g45190

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g45190 not represented in the dataset	Glyma08g45190 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g45190 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma08g45190

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g45190

Limit To All Plant Sequences

>Glyma08g45190.1   sequence type=CDS   gene model=Glyma08g45190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TATGGAAAGACCTTTGATACATTGGAGGGAGCTGATCCGTCAAGCTTAGCCAATAAGGTTGCTAAAGTAGCATGCTCCTGGAGAAGCTGCTTCTCCTGCCAGGAAAAGAGAATTCAACAGCTTGTTGACTCTAATCCTGTCATGCTTTTTATGAAAGGAACTCCTGAAGAGCCAAAATGTGGATTTAGCAGGAAAGCTGTTGATGTGTTGAAGGAAGAGAGAGTCAAGTTTGGAAGTTTTGATGCCCTATCAGATTCAGAGGTTCGTGAAGACTTGAAGAATGGGGAACTGAAGGAAGTTTTTAAAGATCATGGAATTGATACCATTAATGAAGCAAAAGAGAAAGGAGACGGCAAAGGTGGCATCTCTAAATCTACTGATTTGAGTACAACCTTATCCTCTCGTCTTATGAAAGGAAAACCAGATGAACCTAAGTGTGGTTTCAGTAGGAAGGTAGTTGAAATTCTCCAGCAAGAAAATGTTCCCTTTGAGAGTTTTGACATTCTTACTGATGAAGAAGTTCGTCAAGGGCTTAAGGTTTATTCAAACTGGTCCAGTTATCCTCACCTGTATATCAAGGGTGAGCTTATTGGCGGATCAGACATTGTGTTGGAGAATTTAAGAAGAATTTACACGAGAAAGGGATTCTTCCTGCAGAGACCATTCAAGATCGACTGA

Predicted protein sequences of Glyma08g45190

Limit To All Plant Sequences

>Glyma08g45190.1   sequence type=predicted peptide   gene model=Glyma08g45190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YGKTFDTLEGADPSSLANKVAKVACSWRSCFSCQEKRIQQLVDSNPVMLFMKGTPEEPKCGFSRKAVDVLKEERVKFGSFDALSDSEVREDLKNGELKEVFKDHGIDTINEAKEKGDGKGGISKSTDLSTTLSSRLMKGKPDEPKCGFSRKVVEILQQENVPFESFDILTDEEVRQGLKVYSNWSSYPHLYIKGELIGGSDIVLENLRRIYTRKGFFLQRPFKID*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain