SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g45190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g45190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g45190

Feature Type:gene_model
Chromosome:Gm08
Start:44614545
stop:44615366
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G04950AT Annotation by Michelle Graham. TAIR10: thioredoxin family protein | chr4:2517882-2519924 REVERSE LENGTH=488 SoyBaseE_val: 3.00E-76ISS
GO:0000280GO-bp Annotation by Michelle Graham. GO Biological Process: nuclear division SoyBaseN/AISS
GO:0007000GO-bp Annotation by Michelle Graham. GO Biological Process: nucleolus organization SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0072593GO-bp Annotation by Michelle Graham. GO Biological Process: reactive oxygen species metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
PTHR10293Panther GLUTAREDOXIN JGI ISS
PTHR10293:SF17Panther GLUTAREDOXIN-RELATED JGI ISS
PF00462PFAM Glutaredoxin JGI ISS
UniRef100_G7ZZ90UniRef Annotation by Michelle Graham. Most informative UniRef hit: Monothiol glutaredoxin-S17 n=1 Tax=Medicago truncatula RepID=G7ZZ90_MEDTR SoyBaseE_val: 2.00E-94ISS
UniRef100_UPI00023390D8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023390D8 related cluster n=1 Tax=unknown RepID=UPI00023390D8 SoyBaseE_val: 2.00E-126ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g45190 not represented in the dataset

Glyma08g45190 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g45190.1   sequence type=CDS   gene model=Glyma08g45190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TATGGAAAGACCTTTGATACATTGGAGGGAGCTGATCCGTCAAGCTTAGCCAATAAGGTTGCTAAAGTAGCATGCTCCTGGAGAAGCTGCTTCTCCTGCCAGGAAAAGAGAATTCAACAGCTTGTTGACTCTAATCCTGTCATGCTTTTTATGAAAGGAACTCCTGAAGAGCCAAAATGTGGATTTAGCAGGAAAGCTGTTGATGTGTTGAAGGAAGAGAGAGTCAAGTTTGGAAGTTTTGATGCCCTATCAGATTCAGAGGTTCGTGAAGACTTGAAGAATGGGGAACTGAAGGAAGTTTTTAAAGATCATGGAATTGATACCATTAATGAAGCAAAAGAGAAAGGAGACGGCAAAGGTGGCATCTCTAAATCTACTGATTTGAGTACAACCTTATCCTCTCGTCTTATGAAAGGAAAACCAGATGAACCTAAGTGTGGTTTCAGTAGGAAGGTAGTTGAAATTCTCCAGCAAGAAAATGTTCCCTTTGAGAGTTTTGACATTCTTACTGATGAAGAAGTTCGTCAAGGGCTTAAGGTTTATTCAAACTGGTCCAGTTATCCTCACCTGTATATCAAGGGTGAGCTTATTGGCGGATCAGACATTGTGTTGGAGAATTTAAGAAGAATTTACACGAGAAAGGGATTCTTCCTGCAGAGACCATTCAAGATCGACTGA

>Glyma08g45190.1   sequence type=predicted peptide   gene model=Glyma08g45190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YGKTFDTLEGADPSSLANKVAKVACSWRSCFSCQEKRIQQLVDSNPVMLFMKGTPEEPKCGFSRKAVDVLKEERVKFGSFDALSDSEVREDLKNGELKEVFKDHGIDTINEAKEKGDGKGGISKSTDLSTTLSSRLMKGKPDEPKCGFSRKVVEILQQENVPFESFDILTDEEVRQGLKVYSNWSSYPHLYIKGELIGGSDIVLENLRRIYTRKGFFLQRPFKID*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo