SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g45190

Feature Type:gene_model
Chromosome:Gm08
Start:44614545
stop:44615366
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g45190
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G04950AT Annotation by Michelle Graham. TAIR10: thioredoxin family protein | chr4:2517882-2519924 REVERSE LENGTH=488 SoyBaseE_val: 3.00E-76ISS
GO:0000280GO-bp Annotation by Michelle Graham. GO Biological Process: nuclear division SoyBaseN/AISS
GO:0007000GO-bp Annotation by Michelle Graham. GO Biological Process: nucleolus organization SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0072593GO-bp Annotation by Michelle Graham. GO Biological Process: reactive oxygen species metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
PTHR10293Panther GLUTAREDOXIN JGI ISS
PTHR10293:SF17Panther GLUTAREDOXIN-RELATED JGI ISS
PF00462PFAM Glutaredoxin JGI ISS
UniRef100_G7ZZ90UniRef Annotation by Michelle Graham. Most informative UniRef hit: Monothiol glutaredoxin-S17 n=1 Tax=Medicago truncatula RepID=G7ZZ90_MEDTR SoyBaseE_val: 2.00E-94ISS
UniRef100_UPI00023390D8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023390D8 related cluster n=1 Tax=unknown RepID=UPI00023390D8 SoyBaseE_val: 2.00E-126ISS

Expression Patterns of Glyma08g45190
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g45190 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma08g45190
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g45190
>Glyma08g45190.1   sequence type=CDS   gene model=Glyma08g45190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TATGGAAAGACCTTTGATACATTGGAGGGAGCTGATCCGTCAAGCTTAGCCAATAAGGTTGCTAAAGTAGCATGCTCCTGGAGAAGCTGCTTCTCCTGCCAGGAAAAGAGAATTCAACAGCTTGTTGACTCTAATCCTGTCATGCTTTTTATGAAAGGAACTCCTGAAGAGCCAAAATGTGGATTTAGCAGGAAAGCTGTTGATGTGTTGAAGGAAGAGAGAGTCAAGTTTGGAAGTTTTGATGCCCTATCAGATTCAGAGGTTCGTGAAGACTTGAAGAATGGGGAACTGAAGGAAGTTTTTAAAGATCATGGAATTGATACCATTAATGAAGCAAAAGAGAAAGGAGACGGCAAAGGTGGCATCTCTAAATCTACTGATTTGAGTACAACCTTATCCTCTCGTCTTATGAAAGGAAAACCAGATGAACCTAAGTGTGGTTTCAGTAGGAAGGTAGTTGAAATTCTCCAGCAAGAAAATGTTCCCTTTGAGAGTTTTGACATTCTTACTGATGAAGAAGTTCGTCAAGGGCTTAAGGTTTATTCAAACTGGTCCAGTTATCCTCACCTGTATATCAAGGGTGAGCTTATTGGCGGATCAGACATTGTGTTGGAGAATTTAAGAAGAATTTACACGAGAAAGGGATTCTTCCTGCAGAGACCATTCAAGATCGACTGA
Predicted protein sequences of Glyma08g45190
>Glyma08g45190.1   sequence type=predicted peptide   gene model=Glyma08g45190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YGKTFDTLEGADPSSLANKVAKVACSWRSCFSCQEKRIQQLVDSNPVMLFMKGTPEEPKCGFSRKAVDVLKEERVKFGSFDALSDSEVREDLKNGELKEVFKDHGIDTINEAKEKGDGKGGISKSTDLSTTLSSRLMKGKPDEPKCGFSRKVVEILQQENVPFESFDILTDEEVRQGLKVYSNWSSYPHLYIKGELIGGSDIVLENLRRIYTRKGFFLQRPFKID*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo