SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g45010

Feature Type:gene_model
Chromosome:Gm08
Start:44461075
stop:44462458
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g45010
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G01870AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast thylakoid membrane, chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 11 Blast hits to 11 proteins in 5 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 11; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:389846-390319 REVERSE LENGTH=157 SoyBaseE_val: 1.00E-15ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1KYS7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KYS7_SOYBN SoyBaseE_val: 4.00E-109ISS

Expression Patterns of Glyma08g45010
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g45010 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g336100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g45010
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g45010
>Glyma08g45010.1   sequence type=CDS   gene model=Glyma08g45010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGAGTTCCAATTCCCATATTCAATTTCAAATGTTCTTCTCCATGCAGCTTCTTTGCTTCTACAAGCACCCACCACCACTGTTTGTACACAATATTAATGAAGGCATTTTTAAGTACAAGAGGTTTTTCACAAACCCTTCTTCTTCTTCTCGTGGCATAGTTCATGCAGTGAAGGAAGATTCACAATCACAGCAATATGAGGTAGACCCAGATAAAGCCAGAGAAGCACTCAAAAAGCTTGATGAGCAAATCCAGTCTCTCTCCAATAAAAAACAAGTCTCCACTCCAAAACTCAGAGTTTCGGACATGAAGCTTCCCACAGAGCAAGCCAGTCGCAATGATGAGAAGTTAGAAATTTCAGATTCGTTCCTTACAACTTTAGCTGCTGGTCTGGTTCTCTTCACTGTATTTTATAATGTACTATTCTATGCTGTAATTAAGCCTGCCATCGATGGTTCATAA
Predicted protein sequences of Glyma08g45010
>Glyma08g45010.1   sequence type=predicted peptide   gene model=Glyma08g45010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRSSNSHIQFQMFFSMQLLCFYKHPPPLFVHNINEGIFKYKRFFTNPSSSSRGIVHAVKEDSQSQQYEVDPDKAREALKKLDEQIQSLSNKKQVSTPKLRVSDMKLPTEQASRNDEKLEISDSFLTTLAAGLVLFTVFYNVLFYAVIKPAIDGS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo