Glyma08g45000 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g45000

Feature Type:	gene_model
Chromosome:	Gm08
Start:	44453526
stop:	44458109
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g45000

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G56130	AT	Annotation by Michelle Graham. TAIR10: Transducin/WD40 repeat-like superfamily protein \| chr5:22722755-22725065 REVERSE LENGTH=315	SoyBase	E_val: 0	ISS
GO:0010267	GO-bp	Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference	SoyBase	N/A	ISS
GO:0031047	GO-bp	Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0080008	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
KOG1407	KOG	WD40 repeat protein	JGI		ISS
PTHR22839	Panther	THO COMPLEX SUBUNIT 3 (THO3)	JGI		ISS
PF00400	PFAM	WD domain, G-beta repeat	JGI		ISS
UniRef100_G7IY98	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: THO complex subunit n=1 Tax=Medicago truncatula RepID=G7IY98_MEDTR	SoyBase	E_val: 0	ISS
UniRef100_I1KYS6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KYS6_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma08g45000

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g45000

Paralog	Evidence	Comments
Glyma18g07920	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g45000 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g336200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g45000

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g45000

Limit To All Plant Sequences

>Glyma08g45000.1   sequence type=CDS   gene model=Glyma08g45000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGAACAAATCCCATTTAAGAATCTCCATAGCAGAGAGTATTCGGGTCACAAGAAGAAGGTGCACTCTGTGGCTTGGAATTGCATTGGCACAAAACTTGCTTCTGGTTCCGTGGACCAAACTGCGCGAATATGGCATATTGAGCCACATGGGCATGGCAAGGTCAAAGATATTGAATTGAAAGGTCACACTGATAGTGTGGATCAGCTATGCTGGGACCCCAAACATGCTGATTTGATTGCAACTGCATCGGGTGACAAGACTGTTCGTTTGTGGGATGCTCGAAGTGGAAAATGCTCTCAACAGGCGGAACTTAGTGGGGAGAATATTAACATCACTTACAAACCTGATGGGACTCATGTAGCTGTTGGTAACAGGGATGATGAATTAACAATACTGGATGTTCGGAAGTTCAAACCAATTCATAGGCGCAAGTTCAATTATGAGGTAAATGAGATTTCTTGGAACATGACGGGTGAGATGTTCTTTCTAACAACAGGAAATGGGACTGTGGAAGTTCTCTCTTACCCATCTCTTCGACCTCTTGACACTCTCATGGCCCATACAGCTGGTTGTTATTGCATCGCAATTGATCCAGTAGGAAGATATTTTGCTGTTGGAAGTGCTGATTCCCTTGTAAGTCTGTGGGATATATCAGAGATGCTCTGCGTGCGTACCTTCACAAAGCTGGAATGGCCTGTCCGGACAATTGGCTTCAATTATTCTGGAGATTTTATTGCTTCTGCAAGTGAAGACTTGTTCATTGATATTTCAAATGTTCATACTGGAAGAACAGTGCATCAAATTCCTTGTAGGGCTGCTATGAACAGTGTTGAGTGGAATCCTAAATACAATTTACTTGCATATGCTGGTGATGACAAAAACAAGCATCAGGCTGATGAAGGTGTTTTTCGCATTTTTGGTTTTAAAAATGCTTAG

Predicted protein sequences of Glyma08g45000

Limit To All Plant Sequences

>Glyma08g45000.1   sequence type=predicted peptide   gene model=Glyma08g45000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEQIPFKNLHSREYSGHKKKVHSVAWNCIGTKLASGSVDQTARIWHIEPHGHGKVKDIELKGHTDSVDQLCWDPKHADLIATASGDKTVRLWDARSGKCSQQAELSGENINITYKPDGTHVAVGNRDDELTILDVRKFKPIHRRKFNYEVNEISWNMTGEMFFLTTGNGTVEVLSYPSLRPLDTLMAHTAGCYCIAIDPVGRYFAVGSADSLVSLWDISEMLCVRTFTKLEWPVRTIGFNYSGDFIASASEDLFIDISNVHTGRTVHQIPCRAAMNSVEWNPKYNLLAYAGDDKNKHQADEGVFRIFGFKNA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain