Glyma08g44935 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g44935): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g44935): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g44935

Feature Type:	gene_model
Chromosome:	Gm08
Start:	44409208
stop:	44411506
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g44935

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G44100	AT	Annotation by Michelle Graham. TAIR10: amino acid permease 5 \| chr1:16764651-16767223 REVERSE LENGTH=480	SoyBase	E_val: 5.00E-27	ISS
GO:0006865	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid transport	SoyBase	N/A	ISS
GO:0015802	GO-bp	Annotation by Michelle Graham. GO Biological Process: basic amino acid transport	SoyBase	N/A	ISS
GO:0015809	GO-bp	Annotation by Michelle Graham. GO Biological Process: arginine transport	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0015171	GO-mf	Annotation by Michelle Graham. GO Molecular Function: amino acid transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015174	GO-mf	Annotation by Michelle Graham. GO Molecular Function: basic amino acid transmembrane transporter activity	SoyBase	N/A	ISS
PTHR22950	Panther	AMINO ACID TRANSPORTER	JGI		ISS
PF01490	PFAM	Transmembrane amino acid transporter protein	JGI		ISS
UniRef100_B9T659	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Amino acid transporter, putative n=1 Tax=Ricinus communis RepID=B9T659_RICCO	SoyBase	E_val: 1.00E-29	ISS
UniRef100_UPI00023390D1	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023390D1 related cluster n=1 Tax=unknown RepID=UPI00023390D1	SoyBase	E_val: 4.00E-59	ISS

Expression Patterns of Glyma08g44935

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g44935 not represented in the dataset	Glyma08g44935 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g44935 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g336700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g44935

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g44935

Limit To All Plant Sequences

>Glyma08g44935.1   sequence type=CDS   gene model=Glyma08g44935   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGTGAAAACCTCTCTCCCAACTGCTACAAGTGTTATTGGTGCTTATGATGATGATGGGCATGTTAAAAGGACTGGAACTTTATGGAGTGCTGTGGCTCACATCATTACCGCTGTTATTGGTTCTGGTCTTCTCTCTCTTGCATGGAGCACTTCCCAATTAGGATGGATTGGAGGGCCAGTTGCATTTCTTTGTTTTGCAATTATCACCTGTTTCTTCATCTCTCCTTTCTTCATCACTGGGAAAAGAAATTACTCATACATGGCTGCTGTTAGAGTCAACCATGGTAGTGAACTCTTTCCTATTCCCTTGTGCAATCATTGTAGCCACTTTATCATTGTTATTATAACTTATAATTGGATTTAA

Predicted protein sequences of Glyma08g44935

Limit To All Plant Sequences

>Glyma08g44935.1   sequence type=predicted peptide   gene model=Glyma08g44935   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDVKTSLPTATSVIGAYDDDGHVKRTGTLWSAVAHIITAVIGSGLLSLAWSTSQLGWIGGPVAFLCFAIITCFFISPFFITGKRNYSYMAAVRVNHGSELFPIPLCNHCSHFIIVIITYNWI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain