Glyma08g44900 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g44900

Feature Type:	gene_model
Chromosome:	Gm08
Start:	44365036
stop:	44365506
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g44900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G13310	AT	Annotation by Michelle Graham. TAIR10: Chaperone DnaJ-domain superfamily protein \| chr3:4310827-4311300 REVERSE LENGTH=157	SoyBase	E_val: 8.00E-27	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0031072	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding	SoyBase	N/A	ISS
GO:0051082	GO-mf	Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding	SoyBase	N/A	ISS
PTHR24078	Panther	DNAJ HOMOLOG SUBFAMILY C MEMBER	JGI		ISS
PF00226	PFAM	DnaJ domain	JGI		ISS
UniRef100_G7IY77	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Chaperone protein dnaJ n=1 Tax=Medicago truncatula RepID=G7IY77_MEDTR	SoyBase	E_val: 5.00E-49	ISS
UniRef100_I1KYR6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KYR6_SOYBN	SoyBase	E_val: 1.00E-109	ISS

Expression Patterns of Glyma08g44900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g44900

Paralog	Evidence	Comments
Glyma18g08040	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g44900 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g337100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g44900

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g44900

Limit To All Plant Sequences

>Glyma08g44900.1   sequence type=CDS   gene model=Glyma08g44900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGCCAACGCTGAACCTCTCCGCCGTCGGAACTCCTCTCCGTTTCTCCTCCTCCGTCGACCGCTCCGCCAGCTTTCCCCAGCGGAACTCCGTCCGCGCCGTCGCGGAGGAGGCGGTGGAGACACGGCGGCCGGCAGCCAGCCTCTACGATGTGTTGCGAGTCGAGCGAGACGCATCTCCGACGGAGATCAAGTCGGCGTACCGGAGCCTCGCGAAGCTCTTACATCCCGACGCGGCGGTGCGGCGTTCGCCAGAGACAGACGGAGGCGGCGGTTACGTCGACGGAGACTTCATTCAGCTCCGAAACGCGTACGAGACGCTGTCGGATCCGTCGGCGAAGGCGATATACGATATGACGCTGGCGGCGCCGCACGGCGGAAGACACCGCCGGTTTTCTACTCCACTTATTCGGAACCACTCGTCGGCGTTTTACACAACGCGAAGGTGGGAAACAGACCAATGCTGGTAG

Predicted protein sequences of Glyma08g44900

Limit To All Plant Sequences

>Glyma08g44900.1   sequence type=predicted peptide   gene model=Glyma08g44900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPTLNLSAVGTPLRFSSSVDRSASFPQRNSVRAVAEEAVETRRPAASLYDVLRVERDASPTEIKSAYRSLAKLLHPDAAVRRSPETDGGGGYVDGDFIQLRNAYETLSDPSAKAIYDMTLAAPHGGRHRRFSTPLIRNHSSAFYTTRRWETDQCW*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain