Glyma08g44790 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g44790): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g44790): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g44790

Feature Type:	gene_model
Chromosome:	Gm08
Start:	44298694
stop:	44299689
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g44790

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G59810	AT	Annotation by Michelle Graham. TAIR10: Subtilase family protein \| chr5:24096895-24100387 REVERSE LENGTH=778	SoyBase	E_val: 4.00E-41	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0043086	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of catalytic activity	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0004252	GO-mf	Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity	SoyBase	N/A	ISS
GO:0042802	GO-mf	Annotation by Michelle Graham. GO Molecular Function: identical protein binding	SoyBase	N/A	ISS
PTHR10795	Panther	SUBTILISIN/KEXIN-RELATED SERINE PROTEASE	JGI		ISS
PTHR10795:SF17	Panther	gb def: possible protease [sinorhizobium meliloti]	JGI		ISS
PF05922	PFAM	Peptidase inhibitor I9	JGI		ISS
UniRef100_G7IY71	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Subtilisin-like protease n=1 Tax=Medicago truncatula RepID=G7IY71_MEDTR	SoyBase	E_val: 7.00E-62	ISS
UniRef100_I1KYQ8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KYQ8_SOYBN	SoyBase	E_val: 5.00E-86	ISS

Expression Patterns of Glyma08g44790

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g44790 not represented in the dataset	Glyma08g44790 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g44790 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma08g44790

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g44790

Limit To All Plant Sequences

>Glyma08g44790.2   sequence type=CDS   gene model=Glyma08g44790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCATCAAAAGGCCAATCTTATATTGTATACTTAGGATGGCATTCTCATGGCCCAAACCCTTCAGCAAGTGATCTTGAGTTTGCAACAAATCCCCATTACAAATTATTAGGCTCACACTTGGGAAGCCATGAGAAGGCCAAAGAAGCAATATTTTATTCATACAATAAACACAGCAATGGTTTTGCTGTTGTACTTGAAGAGGAACATGCACAAGACATAGCAAAAAATCCAAATGTAGTGTCTGTGTTTCTGAACAAAGGGCATGAATTGCAAACTACTAGATCATGGGAATTTCTTGGGCTAGAAAGTGATGGAGTGGTTCCCAAAGACTCCATATGGGAGAAGGCAAGATATGGTGAGGGTGTAATCATTGCTAACATCGATACAGGTCAGTTTCTTATCCTCATAGTCAAAGTCAAGTTTTTCAAAGGAGGAGGTTGCTTCTTGTCTACAATATTTCCTAAACAAGTATGTACTTTTATTTTGGTGTTTTAA

Predicted protein sequences of Glyma08g44790

Limit To All Plant Sequences

>Glyma08g44790.2   sequence type=predicted peptide   gene model=Glyma08g44790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPSKGQSYIVYLGWHSHGPNPSASDLEFATNPHYKLLGSHLGSHEKAKEAIFYSYNKHSNGFAVVLEEEHAQDIAKNPNVVSVFLNKGHELQTTRSWEFLGLESDGVVPKDSIWEKARYGEGVIIANIDTGQFLILIVKVKFFKGGGCFLSTIFPKQVCTFILVF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain