SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g44080

Feature Type:gene_model
Chromosome:Gm08
Start:43813184
stop:43815519
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g44080
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G16400AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G13175.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr4:9260564-9262102 FORWARD LENGTH=218 SoyBaseE_val: 4.00E-20ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C8YZB6UniRef Annotation by Michelle Graham. Most informative UniRef hit: UPA24 n=1 Tax=Capsicum annuum RepID=C8YZB6_CAPAN SoyBaseE_val: 3.00E-11ISS
UniRef100_I1KYI8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KYI8_SOYBN SoyBaseE_val: 4.00E-62ISS

Expression Patterns of Glyma08g44080
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g44080
ParalogEvidenceComments
Glyma18g08705 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g44080 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g328700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g44080
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g44080
>Glyma08g44080.1   sequence type=CDS   gene model=Glyma08g44080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATATCCAACAACAACTGTTGAAGTTCAGGTACCACATCGGAGGGGCACTCCTCGTGTCCCTTTCGATCTTCTCAGTGCTTTTTCTCGCTCCGAGGTTCCTCAACATCCTCGCCTATTTCTGGCCACTGTTCCTCTCCACCGCGCTTTTTCTCGCCCTCGTTCTCTTCTTCGCCAAGACGCAAACTTCGCCCAACTCCGACGCTTCCATTCCCAAACCCGCCGAGGAGCTCCTCGACTTCGTCGCCGGCCACCATCACAACCCGCCACTCGACGCCCACAAGTCCGATTAG
Predicted protein sequences of Glyma08g44080
>Glyma08g44080.1   sequence type=predicted peptide   gene model=Glyma08g44080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDIQQQLLKFRYHIGGALLVSLSIFSVLFLAPRFLNILAYFWPLFLSTALFLALVLFFAKTQTSPNSDASIPKPAEELLDFVAGHHHNPPLDAHKSD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo