Report for Sequence Feature Glyma08g44071
Feature Type: gene_model
Chromosome: Gm08
Start: 43805707
stop: 43807012
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g44071
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G13130 AT
Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: male gametophyte; Has 140 Blast hits to 132 proteins in 41 species: Archae - 2; Bacteria - 4; Metazoa - 29; Fungi - 20; Plants - 51; Viruses - 0; Other Eukaryotes - 34 (source: NCBI BLink). | chr3:4223008-4223613 FORWARD LENGTH=201
SoyBase E_val: 4.00E-19 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_UPI0002338DE8 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI0002338DE8 related cluster n=1 Tax=unknown RepID=UPI0002338DE8
SoyBase E_val: 0 ISS
Expression Patterns of Glyma08g44071
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g44071
Paralog Evidence Comments
Glyma18g08720 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g44071 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g328600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g44071
Coding sequences of Glyma08g44071
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g44071.1 sequence type=CDS gene model=Glyma08g44071 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGATCATATTAAATCCCACAAAATAGAAGCTTTGATTCAAAGCACAAAATCCCACAACTACCTAATTAAGCTTATCCAATTGTTGGTCCCATTATCTTTATTTTCTTTCTTCGTTTCTCCATCTTCCTTGCTTGCTTTCCTCTACCACTTCAACCTCTACTTCTCTACATTTTCTTTGCAGCTATTTACTCACACCATAGACAAGAATTGCATGTTTCTCCTATGCAATGGACTCCTTGTATTTGTTGGCATAACAAGATCTTTATCTGGGTCTAGTGGTGTTGCTGAAAGTGAATCTTCTTCTAAGTATGTTGAAGATGGATCACAATCTCCATACTCAGATGTTGAGGCTAATGAGGCAATAATATTGGAGGAGAAGGAAGTCATAGAGAAAATTCATGAGCCTCATGGACAGAATACAGAAGCAGAACATGCAATAGAAATCAAGTACTCTAGTGAAGAAGGAGAAGAAGAAAGCATTGGAAACATAATTTTGGAAGGTGAAGAACAAGAAAAAGAAAAAGAGAATAAAGAATCAGTTTTGAAAGATGATAAGGAACCAGAAGGAGAAACTGCATCATTTGGGGCTGGAGAAGAAGACAAGGAGTCAGAAATTGATGAGTTTCTGATTGGAGAAAGTGTTGAAGAGGAAGAAGTTGTAGAAGAACCAAACTGGGTGTTAAGTACTGAGGAGTTGAACAGAAAATTTGATGACTTCATTAGAAAGATGAAGGAAGATTTGAGGATTGAAGCTCAAAGACAATTACTCATGGTTTGTTTTTGA
Predicted protein sequences of Glyma08g44071
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g44071.1 sequence type=predicted peptide gene model=Glyma08g44071 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MDHIKSHKIEALIQSTKSHNYLIKLIQLLVPLSLFSFFVSPSSLLAFLYHFNLYFSTFSLQLFTHTIDKNCMFLLCNGLLVFVGITRSLSGSSGVAESESSSKYVEDGSQSPYSDVEANEAIILEEKEVIEKIHEPHGQNTEAEHAIEIKYSSEEGEEESIGNIILEGEEQEKEKENKESVLKDDKEPEGETASFGAGEEDKESEIDEFLIGESVEEEEVVEEPNWVLSTEELNRKFDDFIRKMKEDLRIEAQRQLLMVCF*