Glyma08g44060 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g44060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g44060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g44060

Feature Type:	gene_model
Chromosome:	Gm08
Start:	43799229
stop:	43801863
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g44060

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G55900	AT	Annotation by Michelle Graham. TAIR10: Haloacid dehalogenase-like hydrolase (HAD) superfamily protein \| chr1:20903163-20905420 FORWARD LENGTH=376	SoyBase	E_val: 4.00E-10	ISS
GO:0000085	GO-bp	Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle	SoyBase	N/A	ISS
GO:0006626	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion	SoyBase	N/A	ISS
GO:0009220	GO-bp	Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0009640	GO-bp	Annotation by Michelle Graham. GO Biological Process: photomorphogenesis	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0009853	GO-bp	Annotation by Michelle Graham. GO Biological Process: photorespiration	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005743	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_G7K4N6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial import inner membrane translocase subunit TIM50 n=1 Tax=Medicago truncatula RepID=G7K4N6_MEDTR	SoyBase	E_val: 8.00E-13	ISS
UniRef100_I1KYI6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KYI6_SOYBN	SoyBase	E_val: 7.00E-116	ISS

Expression Patterns of Glyma08g44060

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g44060 not represented in the dataset	Glyma08g44060 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g44060 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g328500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g44060

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g44060

Limit To All Plant Sequences

>Glyma08g44060.1   sequence type=CDS   gene model=Glyma08g44060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTGCTATACTCTACATCAACGACAGGGATGGATGAGTTGGTCATTTGGATGGCTTCTATATTTATTATTTGTGGTTATGGTGGGAAATGGCCCTCTTTGTGGATAAGTGTGATTTATACTGAACCAATCTCAGACAAGCTCCTTCCAGATTTGCTTCCTCAGGAGCAACATGTTTCTACACTTGATTTAGATCTCAATGAGAGATTGATTCACTATATCTGGACGGCTATCAAGACCTGCTACCAAGTACCAGGATGGGAAGCATTTCAGAGTAGGGACCTTCCAAAGCTAAATAGAAATCCAGGAAAAGTTCTTAAAGTGTCCGTGTTTTGGAAGGTTGCCTTCAACCAGAGAGTTGTGTCCCTATCAAGCCATGGCATTAATATCTGTTCAACTATGAATTCATTTGTTACCCGTAGTAGTACGTCCGGCAAATATAAGACCAGTGATGTGAGATTCCAGCTCAATTCATTACGTGTTCTAAGGATATGA

Predicted protein sequences of Glyma08g44060

Limit To All Plant Sequences

>Glyma08g44060.1   sequence type=predicted peptide   gene model=Glyma08g44060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LLYSTSTTGMDELVIWMASIFIICGYGGKWPSLWISVIYTEPISDKLLPDLLPQEQHVSTLDLDLNERLIHYIWTAIKTCYQVPGWEAFQSRDLPKLNRNPGKVLKVSVFWKVAFNQRVVSLSSHGINICSTMNSFVTRSSTSGKYKTSDVRFQLNSLRVLRI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain