Report for Sequence Feature Glyma08g43950
Feature Type: gene_model
Chromosome: Gm08
Start: 43728423
stop: 43732877
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g43950
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G13120 AT
Annotation by Michelle Graham. TAIR10: Ribosomal protein S10p/S20e family protein | chr3:4220310-4221526 REVERSE LENGTH=191
SoyBase E_val: 5.00E-75 ISS
GO:0006364 GO-bp
Annotation by Michelle Graham. GO Biological Process: rRNA processing
SoyBase N/A ISS
GO:0006412 GO-bp
Annotation by Michelle Graham. GO Biological Process: translation
SoyBase N/A ISS
GO:0009902 GO-bp
Annotation by Michelle Graham. GO Biological Process: chloroplast relocation
SoyBase N/A ISS
GO:0010027 GO-bp
Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization
SoyBase N/A ISS
GO:0015979 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthesis
SoyBase N/A ISS
GO:0015995 GO-bp
Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process
SoyBase N/A ISS
GO:0019288 GO-bp
Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway
SoyBase N/A ISS
GO:0034660 GO-bp
Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009570 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma
SoyBase N/A ISS
GO:0015935 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit
SoyBase N/A ISS
GO:0003723 GO-mf
Annotation by Michelle Graham. GO Molecular Function: RNA binding
SoyBase N/A ISS
GO:0003735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome
SoyBase N/A ISS
KOG0900
KOG
40S ribosomal protein S20
JGI ISS
PTHR11700 Panther
30S RIBOSOMAL PROTEIN S10 FAMILY MEMBER
JGI ISS
PTHR11700:SF5 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF00338 PFAM
Ribosomal protein S10p/S20e
JGI ISS
UniRef100_B9S9Q5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein S10, putative n=1 Tax=Ricinus communis RepID=B9S9Q5_RICCO
SoyBase E_val: 5.00E-80 ISS
UniRef100_C6SYS4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SYS4_SOYBN
SoyBase E_val: 8.00E-147 ISS
Expression Patterns of Glyma08g43950
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g43950
Paralog Evidence Comments
Glyma18g08900 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g43950 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g327500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g43950
Coding sequences of Glyma08g43950
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g43950.1 sequence type=CDS gene model=Glyma08g43950 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGGTTTCTTCTCTCTCTGTTACTCCTCTTTCGCTCTCAAATTCTTCCCCCTCTCTATCTTCCAAGCCAAAGTTTCCATCTTTGTGTTTTCTCTCTGGCAACAACACCACATTGAGGGTAACATGCCCAAAACCTCTGCACTCATCCACTGTTGTTCATGTTGCTACCGAAGCGTTGGATTCATCCCCTGATCCCTTGGACCCACCTCCAGAAACCCTTGATGATGACTCTGACGCCACCACCTTTGAGGTTGGTGACTTGGGGACTCCTAGCACTTCAGCAATTAGCATTGGTGGCGATGCAGATACAATGGCACCAAAGCAGAAGATTAGAATCAAGCTTAGGTCTTACTGGGTGCCCTTGATAGAGGATTCCTGCAAGCAGATATTAGATGCTGCAAGGACTACCAACGCGAAAACAATGGGACCCGTGCCATTACCAACCAAGAAGCGAATCTACTGTGTTCTTAAATCCCCGCACGTACATAAGGATGCCCGGTTCCATTTCGAGATCAGAACTCACCAGCGTCTCATTGATATTCTATATCCTACAGCTCAAACAATAGATTCTCTGATGCAACTTGATCTTCCTGCTGGTGTTGATGTGGAGGTCAAGCTGTAG
Predicted protein sequences of Glyma08g43950
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g43950.1 sequence type=predicted peptide gene model=Glyma08g43950 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAVSSLSVTPLSLSNSSPSLSSKPKFPSLCFLSGNNTTLRVTCPKPLHSSTVVHVATEALDSSPDPLDPPPETLDDDSDATTFEVGDLGTPSTSAISIGGDADTMAPKQKIRIKLRSYWVPLIEDSCKQILDAARTTNAKTMGPVPLPTKKRIYCVLKSPHVHKDARFHFEIRTHQRLIDILYPTAQTIDSLMQLDLPAGVDVEVKL*