|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G13100 | AT | Annotation by Michelle Graham. TAIR10: multidrug resistance-associated protein 7 | chr3:4208859-4214173 REVERSE LENGTH=1493 | SoyBase | E_val: 4.00E-10 | ISS |
| GO:0006810 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transport | SoyBase | N/A | ISS |
| GO:0009627 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance | SoyBase | N/A | ISS |
| GO:0009697 | GO-bp | Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0051707 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to other organism | SoyBase | N/A | ISS |
| GO:0055085 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transmembrane transport | SoyBase | N/A | ISS |
| GO:0005774 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane | SoyBase | N/A | ISS |
| GO:0016021 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0016887 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATPase activity | SoyBase | N/A | ISS |
| GO:0017111 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity | SoyBase | N/A | ISS |
| GO:0042626 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of substances | SoyBase | N/A | ISS |
| UniRef100_B9GWX7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Multidrug resistance protein ABC transporter family n=1 Tax=Populus trichocarpa RepID=B9GWX7_POPTR | SoyBase | E_val: 1.00E-16 | ISS |
| UniRef100_I1KYH1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KYH1_SOYBN | SoyBase | E_val: 1.00E-62 | ISS |
|
Glyma08g43821 not represented in the dataset |
Glyma08g43821 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.08g326400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g43821.1 sequence type=CDS gene model=Glyma08g43821 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATGCACCATCCAACTGATTTTCTCCTCCAACCCAATTTCACTCGTGGGGTATCTGCTTCCCTCAACCTAGTTTTGCTACTTATGCTTGTTGTGTATTGGGTATGGAAGAAAGTGCAAGTGGACAATAGTGAAAAGAGTGAGAGAAAAGGATTCCATAATACTGCTTTCTTGTACTACAAACACAGTCTGGTTTGTAGCTTAGTTATTTGTGTGTTCAACCTTTTGTTGTGCTTACTAAGCTACTTTTACTTGTATAACAATTATGGTTCAGAGGAGCTTGTCACTGCTTCTGATTTGGCTCTCAAAACAGTTGTTTGGGGTTCTGTTTGTGTTTTTTTATATTCTACAAACTCCGAGGCACAGGATCCGAGTTTCCCTCGTTTGTAG
>Glyma08g43821.1 sequence type=predicted peptide gene model=Glyma08g43821 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MMHHPTDFLLQPNFTRGVSASLNLVLLLMLVVYWVWKKVQVDNSEKSERKGFHNTAFLYYKHSLVCSLVICVFNLLLCLLSYFYLYNNYGSEELVTASDLALKTVVWGSVCVFLYSTNSEAQDPSFPRL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||