Glyma08g43605 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g43605

Feature Type:	gene_model
Chromosome:	Gm08
Start:	43399010
stop:	43399940
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g43605

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G55410	AT	Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein \| chr5:22460677-22461081 FORWARD LENGTH=107	SoyBase	E_val: 4.00E-19	ISS
GO:0006869	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid transport	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0008289	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lipid binding	SoyBase	N/A	ISS
PF00234	PFAM	Protease inhibitor/seed storage/LTP family	JGI		ISS
UniRef100_O24101	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: MtN5 protein n=1 Tax=Medicago truncatula RepID=O24101_MEDTR	SoyBase	E_val: 1.00E-27	ISS
UniRef100_UPI0002338C71	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002338C71 related cluster n=1 Tax=unknown RepID=UPI0002338C71	SoyBase	E_val: 1.00E-66	ISS

Expression Patterns of Glyma08g43605

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g43605 not represented in the dataset	Glyma08g43605 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g43605

Paralog	Evidence	Comments
Glyma18g09550	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g43605 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g324100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g43605

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g43605

Limit To All Plant Sequences

>Glyma08g43605.1   sequence type=CDS   gene model=Glyma08g43605   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACATACTAGTGGCAATGCTTTGGTGCAGTGGCTAGTAGCATCATTGCTCATTGCCATGTTGGGTGGTGCCAAAGCTTATGTTTTATGTGACATAGAGTCAAATAAGCTAAGCTTATGCTATGCAGCAGTTACTGGGAGCCACCCTAAAAAACCCAATGAAAAATGCTGTGAAATTGTTCAACATGCCAATTTGCCTTGCCTTTGCAGATACAAGTCTATCCTACCTGCACTTGGAATCAACCCCACCAATGCTTTTGCCTTGCCCAGTAAATGTGGTCTGAAAACACCACCTAAATGTAAAGTGATTTGA

Predicted protein sequences of Glyma08g43605

Limit To All Plant Sequences

>Glyma08g43605.1   sequence type=predicted peptide   gene model=Glyma08g43605   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAHTSGNALVQWLVASLLIAMLGGAKAYVLCDIESNKLSLCYAAVTGSHPKKPNEKCCEIVQHANLPCLCRYKSILPALGINPTNAFALPSKCGLKTPPKCKVI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain