SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g43313): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g43313): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g43313

Feature Type:gene_model
Chromosome:Gm08
Start:43149764
stop:43150784
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g43313
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G51410AT Annotation by Michelle Graham. TAIR10: NAD(P)-binding Rossmann-fold superfamily protein | chr1:19059885-19061424 FORWARD LENGTH=325 SoyBaseE_val: 1.00E-63ISS
GO:0044237GO-bp Annotation by Michelle Graham. GO Biological Process: cellular metabolic process SoyBaseN/AISS
GO:0048610GO-bp Annotation by Michelle Graham. GO Biological Process: cellular process involved in reproduction SoyBaseN/AISS
GO:0048868GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube development SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004022GO-mf Annotation by Michelle Graham. GO Molecular Function: alcohol dehydrogenase (NAD) activity SoyBaseN/AISS
GO:0050662GO-mf Annotation by Michelle Graham. GO Molecular Function: coenzyme binding SoyBaseN/AISS
PTHR10366Panther NAD DEPENDENT EPIMERASE/DEHYDRATASE JGI ISS
PTHR10366:SF9Panther NAD(P)H STEROID DEHYDROGENASE-RELATED JGI ISS
PF01073PFAM 3-beta hydroxysteroid dehydrogenase/isomerase family JGI ISS
UniRef100_G7IYC3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dihydroflavonol-4-reductase n=1 Tax=Medicago truncatula RepID=G7IYC3_MEDTR SoyBaseE_val: 9.00E-70ISS
UniRef100_UPI0002338C64UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338C64 related cluster n=1 Tax=unknown RepID=UPI0002338C64 SoyBaseE_val: 1.00E-83ISS

Expression Patterns of Glyma08g43313
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g43313 not represented in the dataset
Glyma08g43313 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g43313 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g320900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g43313
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g43313
>Glyma08g43313.1   sequence type=CDS   gene model=Glyma08g43313   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTGGTGTGCCAGATGATCCGAAAAAGATAAACCACTTGGTTAGCCTCGATGGTGCTAAGGAGAGGCTGCACCTCTACAAGGCGAATCTTCTCGAAGAAGGTTCCTTTGACTCTGTCTTTCAAGGTTGCCATGCTGTGTTTCACACTGCTTCTCCCTTTTATCACGATGTCAAGGACCCCCAGGCTGAATTGTTAGACCCAGCTTTGAAGGGGACTCTCAATGTTCTGAAGTCGTGTGTGAACTTGCCAACGCTGGAACGTGTCGTTTTAACCTCTTCTGTTGCTGCAGTTGCGTACAACGGAAAGCCTCGTACTCCCGATGTAGTGGTTGATGAGACATGGTTTTCTGACCCGGATTTCTGTAGGGAATCACAGGTATTCTGA
Predicted protein sequences of Glyma08g43313
>Glyma08g43313.1   sequence type=predicted peptide   gene model=Glyma08g43313   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCGVPDDPKKINHLVSLDGAKERLHLYKANLLEEGSFDSVFQGCHAVFHTASPFYHDVKDPQAELLDPALKGTLNVLKSCVNLPTLERVVLTSSVAAVAYNGKPRTPDVVVDETWFSDPDFCRESQVF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo