Glyma08g43290 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g43290): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g43290): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g43290

Feature Type:	gene_model
Chromosome:	Gm08
Start:	43119961
stop:	43122475
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g43290

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G55160	AT	Annotation by Michelle Graham. TAIR10: small ubiquitin-like modifier 2 \| chr5:22383747-22384772 REVERSE LENGTH=103	SoyBase	E_val: 1.00E-57	ISS
GO:0000394	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation	SoyBase	N/A	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0007010	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization	SoyBase	N/A	ISS
GO:0009086	GO-bp	Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0010498	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process	SoyBase	N/A	ISS
GO:0016925	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein sumoylation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0031386	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein tag	SoyBase	N/A	ISS
KOG1769	KOG	Ubiquitin-like proteins	JGI		ISS
PTHR10562	Panther	UBIQUITIN-LIKE PROTEIN SUMO/SMT3-RELATED	JGI		ISS
PF11976	PFAM	Ubiquitin-2 like Rad60 SUMO-like	JGI		ISS
UniRef100_C6T142	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T142_SOYBN	SoyBase	E_val: 5.00E-67	ISS
UniRef100_Q8LSH9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin-like protein SMT3 (Fragment) n=1 Tax=Phaseolus vulgaris RepID=Q8LSH9_PHAVU	SoyBase	E_val: 5.00E-58	ISS

Expression Patterns of Glyma08g43290

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g43290 not represented in the dataset	Glyma08g43290 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g43290 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g320500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g43290

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g43290

Limit To All Plant Sequences

>Glyma08g43290.1   sequence type=CDS   gene model=Glyma08g43290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGGGCGTTACCAACAACAACGAGGAAGACAAGAAGCCAACCGAACAGGGAGCACACATCAACCTTAAGGTTAAGGGGCAGGATGGGAATGAAGTTTTTTTCAGGATCAAGAGAAGCACTCAATTGAAGAAGCTTATGAATGCTTACTGTGACCGACAGTCGGTGGATTTCAACTCCATTGCTTTTCTGTTTGATGGACGCCGCCTCCGAGCTGAGCAGACTCCAGATGAGTTGGAAATGGAGGACGGGGACGAGATTGATGCCATGCTTCACCAGACAGGAGGTTCTGTTGTCTGA

Predicted protein sequences of Glyma08g43290

Limit To All Plant Sequences

>Glyma08g43290.1   sequence type=predicted peptide   gene model=Glyma08g43290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGVTNNNEEDKKPTEQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGSVV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain