Glyma08g43110 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g43110): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g43110): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g43110

Feature Type:	gene_model
Chromosome:	Gm08
Start:	42984607
stop:	42986702
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g43110

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G27340	AT	Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: oxidation reduction; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Gamma-butyrobetaine dioxygenase/Trimethyllysine dioxygenase, N-terminal (InterPro:IPR010376); Has 1035 Blast hits to 1035 proteins in 399 species: Archae - 0; Bacteria - 765; Metazoa - 0; Fungi - 0; Plants - 39; Viruses - 0; Other Eukaryotes - 231 (source: NCBI BLink). \| chr3:10121303-10122692 FORWARD LENGTH=141	SoyBase	E_val: 7.00E-59	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF06155	PFAM	Protein of unknown function (DUF971)	JGI		ISS
UniRef100_I1KYA3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KYA3_SOYBN	SoyBase	E_val: 8.00E-94	ISS
UniRef100_Q8RZ62	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: B1065G12.33 protein n=2 Tax=Oryza sativa Japonica Group RepID=Q8RZ62_ORYSJ	SoyBase	E_val: 4.00E-26	ISS

Expression Patterns of Glyma08g43110

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g43110 not represented in the dataset	Glyma08g43110 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g43110 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g318800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g43110

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g43110

Limit To All Plant Sequences

>Glyma08g43110.1   sequence type=CDS   gene model=Glyma08g43110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTGATAATACAAAACACAAACTCACTTTCGAGAACTATGTTGGCGGCGATTCGGAGAATGACCACAATGCCAGAAGAAACTGCGCGCCTAACCAGATTCTCTCTTCACGCCCCAAAATACGTAGAGGTAGAATTTGGCAATGGTAGTGTGTTCAAGTTATCAGCTGAATTTCTCAGAATAAGTAGTCCTGCAGTTGATGGAAAGATTAGGTCAATTGGAGGTCAAAAGGTGATATCTGGGAGGCGCCATGTGGGAATCATGTCTGCAGAACCAGTAGGAAACTATGGGGTGAGGCTCAATTTTGATGACTTGCATAAGACTGGTATTTATTCTTGGGATTATTTCTATCATCTAGGAAGCAACAAGTTTACCCTTATGAGAAATTACATTAAAACTTTGAAGAAATATGGGCTTAGTCGGGATCCACGTGGAAGGAAATGA

Predicted protein sequences of Glyma08g43110

Limit To All Plant Sequences

>Glyma08g43110.1   sequence type=predicted peptide   gene model=Glyma08g43110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLIIQNTNSLSRTMLAAIRRMTTMPEETARLTRFSLHAPKYVEVEFGNGSVFKLSAEFLRISSPAVDGKIRSIGGQKVISGRRHVGIMSAEPVGNYGVRLNFDDLHKTGIYSWDYFYHLGSNKFTLMRNYIKTLKKYGLSRDPRGRK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain