SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g43110

Feature Type:gene_model
Chromosome:Gm08
Start:42984607
stop:42986702
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g43110
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G27340AT Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: oxidation reduction; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Gamma-butyrobetaine dioxygenase/Trimethyllysine dioxygenase, N-terminal (InterPro:IPR010376); Has 1035 Blast hits to 1035 proteins in 399 species: Archae - 0; Bacteria - 765; Metazoa - 0; Fungi - 0; Plants - 39; Viruses - 0; Other Eukaryotes - 231 (source: NCBI BLink). | chr3:10121303-10122692 FORWARD LENGTH=141 SoyBaseE_val: 7.00E-59ISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF06155PFAM Protein of unknown function (DUF971) JGI ISS
UniRef100_I1KYA3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KYA3_SOYBN SoyBaseE_val: 8.00E-94ISS
UniRef100_Q8RZ62UniRef Annotation by Michelle Graham. Most informative UniRef hit: B1065G12.33 protein n=2 Tax=Oryza sativa Japonica Group RepID=Q8RZ62_ORYSJ SoyBaseE_val: 4.00E-26ISS

Expression Patterns of Glyma08g43110
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g43110 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g318800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g43110
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g43110
>Glyma08g43110.1   sequence type=CDS   gene model=Glyma08g43110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTGATAATACAAAACACAAACTCACTTTCGAGAACTATGTTGGCGGCGATTCGGAGAATGACCACAATGCCAGAAGAAACTGCGCGCCTAACCAGATTCTCTCTTCACGCCCCAAAATACGTAGAGGTAGAATTTGGCAATGGTAGTGTGTTCAAGTTATCAGCTGAATTTCTCAGAATAAGTAGTCCTGCAGTTGATGGAAAGATTAGGTCAATTGGAGGTCAAAAGGTGATATCTGGGAGGCGCCATGTGGGAATCATGTCTGCAGAACCAGTAGGAAACTATGGGGTGAGGCTCAATTTTGATGACTTGCATAAGACTGGTATTTATTCTTGGGATTATTTCTATCATCTAGGAAGCAACAAGTTTACCCTTATGAGAAATTACATTAAAACTTTGAAGAAATATGGGCTTAGTCGGGATCCACGTGGAAGGAAATGA
Predicted protein sequences of Glyma08g43110
>Glyma08g43110.1   sequence type=predicted peptide   gene model=Glyma08g43110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLIIQNTNSLSRTMLAAIRRMTTMPEETARLTRFSLHAPKYVEVEFGNGSVFKLSAEFLRISSPAVDGKIRSIGGQKVISGRRHVGIMSAEPVGNYGVRLNFDDLHKTGIYSWDYFYHLGSNKFTLMRNYIKTLKKYGLSRDPRGRK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo