Glyma08g42900 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g42900

Feature Type:	gene_model
Chromosome:	Gm08
Start:	42849645
stop:	42851919
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g42900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G15700	AT	Annotation by Michelle Graham. TAIR10: ATPase, F1 complex, gamma subunit protein \| chr1:5402629-5403789 REVERSE LENGTH=386	SoyBase	E_val: 2.00E-143	ISS
GO:0015986	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport	SoyBase	N/A	ISS
GO:2000067	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of root morphogenesis	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009544	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast ATP synthase complex	SoyBase	N/A	ISS
GO:0045261	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting ATP synthase complex, catalytic core F(1)	SoyBase	N/A	ISS
GO:0030234	GO-mf	Annotation by Michelle Graham. GO Molecular Function: enzyme regulator activity	SoyBase	N/A	ISS
GO:0046933	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transporting ATP synthase activity, rotational mechanism	SoyBase	N/A	ISS
GO:0046961	GO-mf	Annotation by Michelle Graham. GO Molecular Function: proton-transporting ATPase activity, rotational mechanism	SoyBase	N/A	ISS
KOG1531	KOG	F0F1-type ATP synthase, gamma subunit	JGI		ISS
PTHR11693	Panther	ATP SYNTHASE GAMMA CHAIN	JGI		ISS
PTHR11693:SF9	Panther	ATP SYNTHASE GAMMA-RELATED	JGI		ISS
PF00231	PFAM	ATP synthase	JGI		ISS
UniRef100_I1KY89	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ATP synthase gamma chain n=1 Tax=Glycine max RepID=I1KY89_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_I1KY89	UniRef	Annotation by Michelle Graham. Best UniRef hit: ATP synthase gamma chain n=1 Tax=Glycine max RepID=I1KY89_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma08g42900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g42900 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g317100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g42900

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g42900

Limit To All Plant Sequences

>Glyma08g42900.1   sequence type=CDS   gene model=Glyma08g42900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTTCCCTCTCAAAACCCATCCTTTCTCCGGTTCGCCCCACCCTCCCTCCGGTTCGCTGCGGGTCCCGCGAGCTCCGCGAGCGAATCAAGACCGTCCAAACCACTCAAAAGATCACCGAAGCCATGAAACTCATCTCCGCCGCGCGCGTCCGCCGCGCCCAGGAGGCCGTCGTCAGTGGCCGCCCCTTCTCCTCAAACCTCGCCGCAATGCTAAACGACATCACCCAGCGCCTCCAAAACGACGACGTCTCCACCCCTCTCACCCACGCCAGACCCGTCAGAACCGTTGCACTCGTCGTCGTCACCGCGGACCGCGGCCTCTGCGGCGGCTTCAACAAATCGGTTATCCGAAAAGCCCTCGTACGAATCGAGGAACTGGAAAAACTCAACTTGGGGTGCGTTGTGATCAGCGTTGGCAAAAAGGGTAACTCGTTTTTCACTCACAGTATAAATAAGAAACACCCTTTTGTGAAAGTTGATAGCTTTATCGAAATTGGTGGGTTTCCTACCGCAAAGGAGGCTCAGGTTATCGCCGATGATGTTTTTTCACTGTTTGTTAGTGAGGAGGTTGATAAGGTTGAGCTTGTGTACGCTAAGTTTGTTTCATTGGTTAGGTTTGAGCCTGTGATTCAGAATTTGTTGCCTTTGGGAGAGGTTTGTGATGTGAAAGATGAGATTTTTAGGTTGAGTAGTAAAGAGGGTAAGTTAGCTGTGGAGAGGGATGTTGTGAAGTTGAAAAAAGAGGGTGAGATGTGTTTTCCTCTCATGGAGTTTGAGCAGGATCCTGTTATGATTCTTGATGCCATGTTGCCTCTTTATTTGAATAGTCAGGTTTTGAGGGGTTTGCAGGAGTCTATGGCCAGTGAGCTTGCTGCTAGGATGGTGGCCATGTCAAATGCCACGGATAACGCAGTTGATTTGAGCAAGAGGCTTTCGGTTGAGTACAATCGGGAACGGCAGGCAAAGATCACCGGGGAGTTGTTGGAGATTGTGGCTGGAGCTGAGGCATTAGCAGAAAATGACTGA

Predicted protein sequences of Glyma08g42900

Limit To All Plant Sequences

>Glyma08g42900.1   sequence type=predicted peptide   gene model=Glyma08g42900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFSLSKPILSPVRPTLPPVRCGSRELRERIKTVQTTQKITEAMKLISAARVRRAQEAVVSGRPFSSNLAAMLNDITQRLQNDDVSTPLTHARPVRTVALVVVTADRGLCGGFNKSVIRKALVRIEELEKLNLGCVVISVGKKGNSFFTHSINKKHPFVKVDSFIEIGGFPTAKEAQVIADDVFSLFVSEEVDKVELVYAKFVSLVRFEPVIQNLLPLGEVCDVKDEIFRLSSKEGKLAVERDVVKLKKEGEMCFPLMEFEQDPVMILDAMLPLYLNSQVLRGLQESMASELAARMVAMSNATDNAVDLSKRLSVEYNRERQAKITGELLEIVAGAEALAEND*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain