SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g42630

Feature Type:gene_model
Chromosome:Gm08
Start:42616667
stop:42619481
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G54855AT Annotation by Michelle Graham. TAIR10: Pollen Ole e 1 allergen and extensin family protein | chr5:22282902-22284251 FORWARD LENGTH=146 SoyBaseE_val: 3.00E-71ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF01190PFAM Pollen proteins Ole e I like JGI ISS
UniRef100_C6T474UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T474_SOYBN SoyBaseE_val: 8.00E-103ISS
UniRef100_D7MUX1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pollen ole e 1 allergen and extensin family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MUX1_ARALL SoyBaseE_val: 5.00E-69ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g11660 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g314400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g42630.1   sequence type=CDS   gene model=Glyma08g42630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAAGCAGAAGACAGTGATGGGTTTGATTCTGTTGCTGCTGTTATTTGCTTCGGATGTGAGTGCTTGGACTGGTGAAATCCATGGAAGAGTTGTTTGTGATGTTTGTGGGGATTCTTCTCTCGGACCTGAAGACCATGTTCTCGAAGGTGCTGAGGTTGCTGTTCTTTGCATCACCAAATCTGGGGAGGTTCTAAATTATCAGGCATTCACTGATGCTAAGGGGATATACACAGTGGCCGAGACAATGCCGGAGAGTGATCGTTGGGATGCATGTCTTGCCCGACCAATCAGTAGTTTCCATGAGCAATGCACTCAACTTGGTGAAGGCAGCATTGGGGTTAAATTCAGTTACAATCATCCATCAGGACATTCACACACTGTCAGGACCTTTGTTTATCGACCCACCAGTGTTCCAACTTACTGCATTTGA

>Glyma08g42630.1   sequence type=predicted peptide   gene model=Glyma08g42630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKQKTVMGLILLLLLFASDVSAWTGEIHGRVVCDVCGDSSLGPEDHVLEGAEVAVLCITKSGEVLNYQAFTDAKGIYTVAETMPESDRWDACLARPISSFHEQCTQLGEGSIGVKFSYNHPSGHSHTVRTFVYRPTSVPTYCI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo