Glyma08g42630 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g42630

Feature Type:	gene_model
Chromosome:	Gm08
Start:	42616667
stop:	42619481
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g42630

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G54855	AT	Annotation by Michelle Graham. TAIR10: Pollen Ole e 1 allergen and extensin family protein \| chr5:22282902-22284251 FORWARD LENGTH=146	SoyBase	E_val: 3.00E-71	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF01190	PFAM	Pollen proteins Ole e I like	JGI		ISS
UniRef100_C6T474	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T474_SOYBN	SoyBase	E_val: 8.00E-103	ISS
UniRef100_D7MUX1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pollen ole e 1 allergen and extensin family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MUX1_ARALL	SoyBase	E_val: 5.00E-69	ISS

Expression Patterns of Glyma08g42630

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g42630

Paralog	Evidence	Comments
Glyma18g11660	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g42630 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g314400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g42630

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g42630

Limit To All Plant Sequences

>Glyma08g42630.1   sequence type=CDS   gene model=Glyma08g42630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAAGCAGAAGACAGTGATGGGTTTGATTCTGTTGCTGCTGTTATTTGCTTCGGATGTGAGTGCTTGGACTGGTGAAATCCATGGAAGAGTTGTTTGTGATGTTTGTGGGGATTCTTCTCTCGGACCTGAAGACCATGTTCTCGAAGGTGCTGAGGTTGCTGTTCTTTGCATCACCAAATCTGGGGAGGTTCTAAATTATCAGGCATTCACTGATGCTAAGGGGATATACACAGTGGCCGAGACAATGCCGGAGAGTGATCGTTGGGATGCATGTCTTGCCCGACCAATCAGTAGTTTCCATGAGCAATGCACTCAACTTGGTGAAGGCAGCATTGGGGTTAAATTCAGTTACAATCATCCATCAGGACATTCACACACTGTCAGGACCTTTGTTTATCGACCCACCAGTGTTCCAACTTACTGCATTTGA

Predicted protein sequences of Glyma08g42630

Limit To All Plant Sequences

>Glyma08g42630.1   sequence type=predicted peptide   gene model=Glyma08g42630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKQKTVMGLILLLLLFASDVSAWTGEIHGRVVCDVCGDSSLGPEDHVLEGAEVAVLCITKSGEVLNYQAFTDAKGIYTVAETMPESDRWDACLARPISSFHEQCTQLGEGSIGVKFSYNHPSGHSHTVRTFVYRPTSVPTYCI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain