Report for Sequence Feature Glyma08g42570
Feature Type: gene_model
Chromosome: Gm08
Start: 42576120
stop: 42576759
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g42570
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G50360 AT
Annotation by Michelle Graham. TAIR10: centrin2 | chr3:18674421-18675502 FORWARD LENGTH=169
SoyBase E_val: 4.00E-32 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0030048 GO-bp
Annotation by Michelle Graham. GO Biological Process: actin filament-based movement
SoyBase N/A ISS
GO:0051645 GO-bp
Annotation by Michelle Graham. GO Biological Process: Golgi localization
SoyBase N/A ISS
GO:0051646 GO-bp
Annotation by Michelle Graham. GO Biological Process: mitochondrion localization
SoyBase N/A ISS
GO:0060151 GO-bp
Annotation by Michelle Graham. GO Biological Process: peroxisome localization
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0005509 GO-mf
Annotation by Michelle Graham. GO Molecular Function: calcium ion binding
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
PTHR10891 Panther
CALMODULIN
JGI ISS
PTHR10891:SF41 Panther
CALMODULIN RELATED
JGI ISS
PF00036 PFAM
EF hand
JGI ISS
UniRef100_G7KY76 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Caltractin n=1 Tax=Medicago truncatula RepID=G7KY76_MEDTR
SoyBase E_val: 5.00E-37 ISS
UniRef100_I1KY52 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KY52_SOYBN
SoyBase E_val: 1.00E-53 ISS
Expression Patterns of Glyma08g42570
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma08g42570 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma08g42570
Coding sequences of Glyma08g42570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g42570.1 sequence type=CDS gene model=Glyma08g42570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGATTGAGTTGAATTTGCAACAAATTAATCAAATGATAGCAGATGTGGACAAGGATGGAAGTGGAGCAATTGATTATGAAGAATTTGAGTACATGATGACAGCCAAAATAGGAGAGCGGGACAGTAAAGAGGAGCTCATGAAAGCTTTGCATACTATTGATCATGATAAAAATGGAAAGATATCTGCATCAGACAACAACCGCATTGCAAAAGAGCTAGGTCAAAATTTCACTGACAGAGATTCAGGAGATGATTGA
Predicted protein sequences of Glyma08g42570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g42570.1 sequence type=predicted peptide gene model=Glyma08g42570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MIELNLQQINQMIADVDKDGSGAIDYEEFEYMMTAKIGERDSKEELMKALHTIDHDKNGKISASDNNRIAKELGQNFTDRDSGDD*