SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g42515

Feature Type:gene_model
Chromosome:Gm08
Start:42509513
stop:42513990
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G07610AT Annotation by Michelle Graham. TAIR10: Transcription factor jumonji (jmjC) domain-containing protein | chr3:2426148-2432876 FORWARD LENGTH=1027 SoyBaseE_val: 5.00E-94ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006487GO-bp Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0032776GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation on cytosine SoyBaseN/AISS
GO:0033169GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-K9 demethylation SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0032454GO-mf Annotation by Michelle Graham. GO Molecular Function: histone demethylase activity (H3-K9 specific) SoyBaseN/AISS
PTHR12549Panther JUMONJI DOMAIN CONTAINING PROTEIN-RELATED INCLUDING HAIRLESS JGI ISS
UniRef100_G7ZXC7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Lysine-specific demethylase 3B n=1 Tax=Medicago truncatula RepID=G7ZXC7_MEDTR SoyBaseE_val: 5.00E-137ISS
UniRef100_I1LN06UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LN06_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g42515 not represented in the dataset

Glyma08g42515 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g42515.1   sequence type=CDS   gene model=Glyma08g42515   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTATTTCCTACGGTGTTGGTTATGTGTCATGTCTTGTCTACTATTGACACATCATATTGGGTCAACATTTTGTCTGAGTTAGTGTGTAAAGCAAAAGAACTAGTGCAAGCATACAAGCTTCAAAATGTAGTTAAGACTGCAGACAACTTCTGTTCATGTTTGAAGCTTGATAGAAACACAGATGTTAGCTATAATTTGACTGACAACTATTTATTCTGTCCTAAAGCTGTAGATCCTCAGTACAAGGATTTAAGGCATTTTCAGTGGCATTGGGAAAAGGGGGAGCCTGTCATTGTCAGCAATGTGCTTGAATGTACATCTGGTTTAAGCTGGGAACCGCTTGTCATGTGGCGTGCATTACGTCATGTAACTAATACCAAGCATGGCCAACATTTGGCGGAGAAAACAATTGATTGCTTAGATTGCACTGAGGGGGAAATTAATATCCACCAATTTTTTACTGGCTATACAAATGGTCGTAGGGATTGGCTTGCTTGGCCACAGATATTGAAATTAAAAGATTGGCCTCCTTCTAATTTATTTGAGGAACAATTGCCTCGTCATTGTGCTGAGTTCATATCTTCCTTACCCTTCAAGGAATATACTGATCCTCACAAAGGTTCTCTTAACCTTGCTGTGAAGTTGCCTAATGGTTCTCTAAAGCCAGACCTGGGGCCAAAAACATATATTGCTTATGGATTTCCTCAGGAGCTTGGACGTGGTGATTCAGTGACTAAGCTCCATTGTGATATGTCTGATGCAGTAAATGTGTTGACTCATATTGCTGAAGTGAAACTGGATTCTGATCAACTTACTGTCATTGAGAAGTTGAAGCAAAAGCATCTCGAGCAAGAGAAAAGGGAGCTACTTGGTGATGATCAGGATGGAGAAACTAATGTTGACATGCTTAATATAATTCATCTTCTACAATAA

>Glyma08g42515.1   sequence type=predicted peptide   gene model=Glyma08g42515   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLFPTVLVMCHVLSTIDTSYWVNILSELVCKAKELVQAYKLQNVVKTADNFCSCLKLDRNTDVSYNLTDNYLFCPKAVDPQYKDLRHFQWHWEKGEPVIVSNVLECTSGLSWEPLVMWRALRHVTNTKHGQHLAEKTIDCLDCTEGEINIHQFFTGYTNGRRDWLAWPQILKLKDWPPSNLFEEQLPRHCAEFISSLPFKEYTDPHKGSLNLAVKLPNGSLKPDLGPKTYIAYGFPQELGRGDSVTKLHCDMSDAVNVLTHIAEVKLDSDQLTVIEKLKQKHLEQEKRELLGDDQDGETNVDMLNIIHLLQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo