Glyma08g42125 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g42125

Feature Type:	gene_model
Chromosome:	Gm08
Start:	42060404
stop:	42060952
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g42125

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
PF05678	PFAM	VQ motif	JGI		ISS
UniRef100_G7IXH6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=G7IXH6_MEDTR	SoyBase	E_val: 3.00E-53	ISS

Proteins Associated with Glyma08g42125

Locus	Gene Symbol	Protein Name
	VQ42	VQ motif containing protein gene 42

Expression Patterns of Glyma08g42125

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g42125 not represented in the dataset	Glyma08g42125 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g42125

Paralog	Evidence	Comments
Glyma18g13001	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g42125 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g308400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g42125

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g42125

Limit To All Plant Sequences

>Glyma08g42125.1   sequence type=CDS   gene model=Glyma08g42125   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAGGAAAGTAAGTCAAGAATCACTGAAAATATCTAAGGTTGATCATCAGAAACATCAATTCAACACTTTGATCAAGGTCTTGAGGCCTAAGGTCTACATCACTGACAGCTCAAGCTTCAAGAAGTTAGTTCAAGAGCTAACTGGCAATGGAAGTTCCAATAACACTTTGTCTCCACCTCCTTTGGAACCAAACATGGTCGAAAATTTCCCCCTTAATATTGGAACTGAGCCTCATGAGAGTGACCTTCAAACTAGTCCTGATGATGTGTCAATTTCTCCTGAAGCAACTAGCAACTCACCTGAGTTGTGCTGTGATGCATTGATGAATGAAGAATTTAACCTAGTTTGCAACCAGTTATGCTTAGATGACCTAGCCTTCCAACAAGACTCAGTGACCAACCAATCTATAGACCATTTTTTGGCATACCAGAATCTTGAGTCACTACTGCTTGATGTTGAATCAAATCCCTTGTACAACTGTTATGAACAGATGATGCAGCCAGATGTCAGCATATATGATTATGAGTTGTCAGGATTACTATGA

Predicted protein sequences of Glyma08g42125

Limit To All Plant Sequences

>Glyma08g42125.1   sequence type=predicted peptide   gene model=Glyma08g42125   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRKVSQESLKISKVDHQKHQFNTLIKVLRPKVYITDSSSFKKLVQELTGNGSSNNTLSPPPLEPNMVENFPLNIGTEPHESDLQTSPDDVSISPEATSNSPELCCDALMNEEFNLVCNQLCLDDLAFQQDSVTNQSIDHFLAYQNLESLLLDVESNPLYNCYEQMMQPDVSIYDYELSGLL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain