SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g41915): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g41915): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g41915

Feature Type:gene_model
Chromosome:Gm08
Start:41805536
stop:41806671
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G75280AT Annotation by Michelle Graham. TAIR10: NmrA-like negative transcriptional regulator family protein | chr1:28252030-28253355 FORWARD LENGTH=310 SoyBaseE_val: 3.00E-51ISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
PTHR10366Panther NAD DEPENDENT EPIMERASE/DEHYDRATASE JGI ISS
PTHR10366:SF62Panther EPIMERASE-RELATED JGI ISS
PF05368PFAM NmrA-like family JGI ISS
UniRef100_Q9SDZ1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Isoflavone reductase homolog 1 n=1 Tax=Glycine max RepID=Q9SDZ1_SOYBN SoyBaseE_val: 2.00E-58ISS
UniRef100_UPI000233898FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233898F related cluster n=1 Tax=unknown RepID=UPI000233898F SoyBaseE_val: 2.00E-85ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g41915 not represented in the dataset

Glyma08g41915 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g306400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g41915.1   sequence type=CDS   gene model=Glyma08g41915   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCCAAGAGCAAAATCCTAGTCCTTGGAGGAACAAGTTACATTGGAAAATTCATAGTTATGGCAAGCGTAGAAGCAGGTCACTCCACTTTTGCCTTAGTTAGGGAGAGCACCCTTTCTCATCCTCAAAAGTCTAAACTTATTCAGAGCTTCAAGAGCTTTGGAGTTACTCTTCTTTATGGTGATGTAAATAATCATGAAAGCCTTGTTAAGGCAATTAAGCAAGTTGATGTTCTAATATTTACACTAGCAATAAAAGAAGCTGGAAACATCAATTCATCTGGATTAGATGTGGACCATAACAGGGCAGTTGAGCCATCGGCCAGCTTTTTCGACAAAATAGTGAAAATCAAAAGGGCAATTGAAGCTGAAGGAATCCCTTACACTTACTTG

>Glyma08g41915.1   sequence type=predicted peptide   gene model=Glyma08g41915   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAKSKILVLGGTSYIGKFIVMASVEAGHSTFALVRESTLSHPQKSKLIQSFKSFGVTLLYGDVNNHESLVKAIKQVDVLIFTLAIKEAGNINSSGLDVDHNRAVEPSASFFDKIVKIKRAIEAEGIPYTYL







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo